Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (uncharacterized)
to candidate WP_011765688.1 AZO_RS09880 indole acetimide hydrolase
Query= curated2:Q67KJ2 (488 letters) >NCBI__GCF_000061505.1:WP_011765688.1 Length = 485 Score = 205 bits (522), Expect = 2e-57 Identities = 161/474 (33%), Positives = 229/474 (48%), Gaps = 37/474 (7%) Query: 13 AGELSAVEIAESALSRIAQVEPAVGAFITVAADHVIERAKKLDARRKAGDTELGPLAGVP 72 AG LS + ++R AQ P + FIT+ AD+ + A++ D R AG + GPLAG+P Sbjct: 27 AGSLSCEALMRDCIAR-AQAHPELNIFITLDADNALAAARRADTARAAGQPQ-GPLAGLP 84 Query: 73 IAVKDNICTSGMETTCASRILKGYVSPFDATVVERLRAAGAMIIGKANMDEFAMGSSGES 132 I VKDNI +G+ T + L +V DA V +LR AGA+I+GK NM E A G++G + Sbjct: 85 IVVKDNIHAAGLPATAGTPALADFVPAQDAPTVRKLREAGAVILGKTNMHELAFGATGYN 144 Query: 133 SAF------GVTRNPWDLERVPGGSSSGSAAAVAAGEAPLALGTDTGGSIRQPAAFTGIV 186 AF GV RNP+D R+ GGSSSGSAAA+ A A ALGTDTGGS+R P A G Sbjct: 145 HAFHHPDSVGV-RNPYDPSRIAGGSSSGSAAALGARMAVAALGTDTGGSMRIPCALNGCA 203 Query: 187 GLKPTYGYVSRYGVVAFASSLDQVGPMGRDVEDVARLFEVIAGPDRRDATNAGRTPPALK 246 L+P++G S GV+ A+S D VGPM + DVA L +I+G Sbjct: 204 SLRPSWGRYSGQGVIPIANSRDTVGPMALCMADVALLDALISGEQALHPVR--------- 254 Query: 247 FGGEPSLSGVRLGVPKELLGPGIDPGVKARVEEAIAQLEELGAT-VEECSLPSTEYALSA 305 L +RLGV + +D +A + A+ +LE G +E E Sbjct: 255 ------LDSLRLGV-VDSFWANLDDDTRALTDAAVKKLEAAGVRFIEVPDARLKELNEPI 307 Query: 306 YYVIAVAEASSNLARFDGVRYGYRAAQAGGLHEMYSKTRGEGFGTEV---KRRIMLGTYV 362 + + EA ++ + +R L+E + +G ++ ++ G + Sbjct: 308 GFAVVFHEAYDDMVAY--LREQGPGISIETLYEQIASPDVKGLYRDLVLARKTFGPGGTL 365 Query: 363 LSAGHYDAYYRRAQQVRTLVVRDFERAFERY--DALVTPTTPFTAWKIGEKVDDPVSMYL 420 + G AY + R + + FERY DA V PTTP A +V P + Sbjct: 366 VDVG--PAYQEAVRHGRPALKARYRELFERYQLDAFVFPTTPVVAPLARPEVSLPENFQA 423 Query: 421 GDICTIPVNLAGLPAVSVPCGF--VDGLPVGMQLIGKPFADTQILQIAWAYQKV 472 T P A L ++ +P G GLPVGM+L G D ++L I A + V Sbjct: 424 LIQNTEPAASACLASIQLPIGLGPRTGLPVGMELDGPAGGDRRLLSIGMALEAV 477 Lambda K H 0.318 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 652 Number of extensions: 45 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 488 Length of database: 485 Length adjustment: 34 Effective length of query: 454 Effective length of database: 451 Effective search space: 204754 Effective search space used: 204754 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory