Align aspartate semialdehyde dehydrogenase subunit (EC 1.2.1.11) (characterized)
to candidate WP_013136029.1 ARNIT_RS11090 aspartate-semialdehyde dehydrogenase
Query= metacyc::MONOMER-6564 (346 letters) >NCBI__GCF_000092245.1:WP_013136029.1 Length = 345 Score = 286 bits (733), Expect = 4e-82 Identities = 163/340 (47%), Positives = 224/340 (65%), Gaps = 11/340 (3%) Query: 3 RGLHVAVVGATGAVGQQMLKTLEDRNFEMDTLTLLSSKRSAGTKVTFKGQELTVQEASPE 62 R +VAVVGATGAVG+++ + +E +F ++ + L+S RS G+ + +K +E+ V E + Sbjct: 2 RRFNVAVVGATGAVGEELFRVMEAYDFPINKIVPLASARSLGSTIEYKNKEINVLELTET 61 Query: 63 SFEG--VNIALFSAGGSVSQALAPEAVKRGAIVIDNTSAFRMDENTPLVVPEVNEAD--L 118 FE V+IA FSAGGS+S+ A AV+ GA+VIDNTS FRMDEN PLVVPEVN D L Sbjct: 62 CFEENEVDIAFFSAGGSISEKFAKYAVEAGAVVIDNTSHFRMDENVPLVVPEVNPQDIAL 121 Query: 119 HEHNGIIANPNCSTIQMVAALEPIRKAYGLNKVIVSTYQAVSGAGNEAVKELYSQTQAIL 178 + GIIANPNCSTIQMV +L+P+ + YG+ +V VSTYQAVSGAG + ++EL Q Q +L Sbjct: 122 WKETGIIANPNCSTIQMVLSLKPLDELYGIKRVDVSTYQAVSGAGKKGMEELIKQMQDML 181 Query: 179 NKEEIEPEIMPVKGDKKHYQIAFNAIPQIDKFQDNGYTFEEMKMINETKKIMHMPDLQVA 238 + + + +I + ++I N IPQID Q NG+T EEMKM+ ET+KIMH +Q+A Sbjct: 182 SFKLDDTKI-----EAFAHRIVNNVIPQIDVAQPNGFTKEEMKMVKETQKIMH-KSMQIA 235 Query: 239 ATCVRLPIQTGHSESVYIEI-DRDDATVEDIKNLLKEAPGVTLQDDPSQQLYPMPADAVG 297 ATCVR+P+ HSES+ + D D V ++ L + V + DD YPMP + Sbjct: 236 ATCVRVPVLRSHSESITVTFEDGVDVDVNAVREALAKFENVEVIDDLENNAYPMPIVSTD 295 Query: 298 KNDVFVGRIRKDLDRANGFHLWVVSDNLLKGAAWNSVQIA 337 + FVGRIRKD+ +N H + V+D + GAA NSV+IA Sbjct: 296 TDTTFVGRIRKDIYSSNVVHYFNVADQVRVGAATNSVRIA 335 Lambda K H 0.314 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 324 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 345 Length adjustment: 29 Effective length of query: 317 Effective length of database: 316 Effective search space: 100172 Effective search space used: 100172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
Align candidate WP_013136029.1 ARNIT_RS11090 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.28188.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-129 418.3 6.7 1.3e-129 418.1 6.7 1.0 1 lcl|NCBI__GCF_000092245.1:WP_013136029.1 ARNIT_RS11090 aspartate-semialde Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000092245.1:WP_013136029.1 ARNIT_RS11090 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 418.1 6.7 1.3e-129 1.3e-129 1 337 [. 5 339 .. 5 341 .. 0.98 Alignments for each domain: == domain 1 score: 418.1 bits; conditional E-value: 1.3e-129 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfeg..idialf 67 nva+vGatGavG+el +v+e +fpi+k+v+las+rs G +++k+ke++v e++++ fe+ +dia+f lcl|NCBI__GCF_000092245.1:WP_013136029.1 5 NVAVVGATGAVGEELFRVMEAYDFPINKIVPLASARSLGSTIEYKNKEINVLELTETCFEEneVDIAFF 73 79******************************************************9998777****** PP TIGR01296 68 saGgsvskefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvL 136 saGgs+s++fa a++ag++viDnts fr+de+vPLvvpevn ++++ k+ giianPnCstiq+v L lcl|NCBI__GCF_000092245.1:WP_013136029.1 74 SAGGSISEKFAKYAVEAGAVVIDNTSHFRMDENVPLVVPEVNPQDIALWKETGIIANPNCSTIQMVLSL 142 ********************************************************************* PP TIGR01296 137 kplkdeaklkrvvvstYqavsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplid 205 kpl++ +++krv vstYqavsGaGkkg+eeL +q++ +l++k ++ k ++fa++i n+ip+id lcl|NCBI__GCF_000092245.1:WP_013136029.1 143 KPLDELYGIKRVDVSTYQAVSGAGKKGMEELIKQMQDMLSFKLDDT-----KIEAFAHRIVNNVIPQID 206 *****************************************99986.....8899************** PP TIGR01296 206 klkedGytkeelkllfetrkilgiedlkvsatcvrvPvftghsesvsiefek..elsveevkelLkeap 272 + +G+tkee+k++ et+ki++ + ++++atcvrvPv+++hses+++ fe+ +++v+ v+e L + + lcl|NCBI__GCF_000092245.1:WP_013136029.1 207 VAQPNGFTKEEMKMVKETQKIMH-KSMQIAATCVRVPVLRSHSESITVTFEDgvDVDVNAVREALAKFE 274 ***********************.9**************************98889999********** PP TIGR01296 273 gvvviddpsenlyptPleavgkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaelli 337 v vidd ++n+yp+P+ +++d +fvgrirkD+ +++ ++ f vaD++r+Gaa+n+v+ia ++i lcl|NCBI__GCF_000092245.1:WP_013136029.1 275 NVEVIDDLENNAYPMPIVSTDTDTTFVGRIRKDIYSSNVVHYFNVADQVRVGAATNSVRIALKWI 339 *************************************************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (345 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 10.24 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory