Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_013092090.1 BC1002_RS21455 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::Q9K169 (351 letters) >NCBI__GCF_000092885.1:WP_013092090.1 Length = 372 Score = 414 bits (1064), Expect = e-120 Identities = 209/346 (60%), Positives = 256/346 (73%), Gaps = 5/346 (1%) Query: 8 DDIKIKEVKELLPPIAHLYELPISKEASGLVHRTRQEISDLVHGRDKRLLVIIGPCSIHD 67 DD++I V+ L+ P ELP+ LV +TR EI+D++HGRD RL++I+GPCSIHD Sbjct: 26 DDVRIGAVRPLISPALLQDELPVPPAVQTLVEKTRVEIADILHGRDDRLVLIVGPCSIHD 85 Query: 68 PKAALEYAERLLKLRKQYENELLIVMRVYFEKPRTTVGWKGLINDPHLDGTFDINFGLRQ 127 A+EYA +L Y ++LLIVMRVYFEKPRTTVGWKG INDP LDG+F IN GLR+ Sbjct: 86 HDQAIEYARKLKAAADHYRDDLLIVMRVYFEKPRTTVGWKGYINDPRLDGSFRINEGLRR 145 Query: 128 ARSLLLSLNNMGMPASTEFLDMITPQYYADLISWGAIGARTTESQVHRELASGLSCPVGF 187 AR LLL +N +G+ +TEFLD+++PQY ADLI+WGAIGARTTESQ HR+LASGLSCP+GF Sbjct: 146 ARQLLLDINGLGLATATEFLDLLSPQYIADLIAWGAIGARTTESQSHRQLASGLSCPIGF 205 Query: 188 KNGTDGNLKIAIDAIGAASHSHHFLSVTKAGHSAIVHTGGNPDCHVILRGGKE-PNYDAE 246 KNGTDG ++IA DAI AA SH F+ +TK G +AI T GN D HVILRGGK+ PNYD+ Sbjct: 206 KNGTDGGVQIAADAIVAARASHAFMGITKMGMAAIFETRGNDDAHVILRGGKKGPNYDSA 265 Query: 247 HVSEAAEQLRAAGVTDKLMIDCSHANSRKDYTRQMEVAQDIAAQLEQDGGNIMGVMVESH 306 V E LR+AG+ +++MIDCSHANS K + RQ+EVA DIA QL G I+GVM+ESH Sbjct: 266 SVQATCEALRSAGLREQVMIDCSHANSNKSHMRQIEVADDIARQLSAREGRIIGVMLESH 325 Query: 307 LVEGRQD----KPEVYGKSITDACIGWGATEELLALLAGANKKRMA 348 L EGRQD P YG SITDAC+ W TE +LA LA A +KR A Sbjct: 326 LEEGRQDLKAGVPLRYGVSITDACVSWAQTEPVLATLAEATRKRRA 371 Lambda K H 0.318 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 372 Length adjustment: 29 Effective length of query: 322 Effective length of database: 343 Effective search space: 110446 Effective search space used: 110446 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_013092090.1 BC1002_RS21455 (3-deoxy-7-phosphoheptulonate synthase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.7727.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-158 510.4 0.0 1e-157 510.2 0.0 1.0 1 lcl|NCBI__GCF_000092885.1:WP_013092090.1 BC1002_RS21455 3-deoxy-7-phospho Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000092885.1:WP_013092090.1 BC1002_RS21455 3-deoxy-7-phosphoheptulonate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 510.2 0.0 1e-157 1e-157 1 342 [] 26 370 .. 26 370 .. 0.99 Alignments for each domain: == domain 1 score: 510.2 bits; conditional E-value: 1e-157 TIGR00034 1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyak 69 dd+ri ++ +l++P+ l+ + p+ +++++ v+k+r eiadil+G+ddrl++++GPcsihd a+eya+ lcl|NCBI__GCF_000092885.1:WP_013092090.1 26 DDVRIGAVRPLISPALLQDELPVPPAVQTLVEKTRVEIADILHGRDDRLVLIVGPCSIHDHDQAIEYAR 94 799****************************************************************** PP TIGR00034 70 rlkklaeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplate 138 +lk+ a++++ddl ivmrvyfekPrttvGWkG indP l++sf++n+Glr ar+llld++ lgl +ate lcl|NCBI__GCF_000092885.1:WP_013092090.1 95 KLKAAADHYRDDLLIVMRVYFEKPRTTVGWKGYINDPRLDGSFRINEGLRRARQLLLDINGLGLATATE 163 ********************************************************************* PP TIGR00034 139 lldtispqyladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsv 207 +ld spqy+adl++wgaiGarttesq hr+lasgls+p+gfkngtdG++++a dai aa+a+h f+++ lcl|NCBI__GCF_000092885.1:WP_013092090.1 164 FLDLLSPQYIADLIAWGAIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQIAADAIVAARASHAFMGI 232 ********************************************************************* PP TIGR00034 208 tkaGqvaivetkGnedghiilrGGkk.pnydaedvaevkeelekaglkeelmidfshgnsnkdykrqle 275 tk G +ai et+Gn+d+h+ilrGGkk pnyd+++v++++e l+ agl+e++mid+sh+nsnk + rq+e lcl|NCBI__GCF_000092885.1:WP_013092090.1 233 TKMGMAAIFETRGNDDAHVILRGGKKgPNYDSASVQATCEALRSAGLREQVMIDCSHANSNKSHMRQIE 301 ********************************************************************* PP TIGR00034 276 vaesvveqiaeGekaiiGvmiesnleeGnqsl..keelkyGksvtdacigwedteallrklaeavkerr 342 va+++++q++ e iiGvm+es+leeG+q+l + +l yG+s+tdac++w +te +l+ laea ++rr lcl|NCBI__GCF_000092885.1:WP_013092090.1 302 VADDIARQLSAREGRIIGVMLESHLEEGRQDLkaGVPLRYGVSITDACVSWAQTEPVLATLAEATRKRR 370 *******************************9444579**************************99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.28 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory