Align Threonine synthase; TS; EC 4.2.3.1 (uncharacterized)
to candidate WP_013092608.1 BC1002_RS24075 hydroxyectoine utilization dehydratase EutB
Query= curated2:Q9K7E3 (354 letters) >NCBI__GCF_000092885.1:WP_013092608.1 Length = 343 Score = 82.0 bits (201), Expect = 2e-20 Identities = 86/296 (29%), Positives = 131/296 (44%), Gaps = 18/296 (6%) Query: 31 TPLIPLENLSKEWGVKAYVKYEGANPTGSFKDRGMVMAVAKAKEEGSRTIICASTGNTSA 90 TPL+ +LS G Y+K E PTGSFK RG A+A+ E+G ++ ASTGN Sbjct: 28 TPLVESPSLSAHTGTPVYLKLETVQPTGSFKLRGATNALAQLAEQGCTRVVTASTGNHGR 87 Query: 91 AAAAYGARAGLRCIVVIPEGKIALGKLAQAVMYGAEVLEIKGNFDHA-LDIVRSISEKEP 149 A A G+ V + + K+ GA V + D A + +R SE+ Sbjct: 88 AVAHAARALGIDATVCLSR-LVPANKVDAVRALGAHVRIAGQSQDEAEHEALRLASEEGY 146 Query: 150 ITLVNSVNPYRIEGQKTSAFEICDALGQAPDV--LAIPVGNAGNITAYWKGFKEYHEKKG 207 + +P I GQ T EI +AL PDV + +P+ G K G Sbjct: 147 AYVPPFDDPRVIAGQGTIGLEIVEAL---PDVANIVVPLSGGGLFAGIALAAKSTSPTIG 203 Query: 208 -TGLPQMRGFEAEGAAAIVRNQVIEEPETIATAI--RIGNPASWTYAVEAAAESNGKIDE 264 TG+ RG + A+ + ++EE +T+A ++ IG +TYA+ + IDE Sbjct: 204 LTGVTMARGAAMHASLAVGQPVLVEEVDTLADSLGGGIGLENRYTYAL-----TRDLIDE 258 Query: 265 --VTDEEILAAYQLLA-QKEGVFAEPASCASIAGLRKQIASGEIKKGSTVVCVLTG 317 + DE +A A ++E + E A+ IA + + E +V V+TG Sbjct: 259 TVLLDEASIARGIAHAYRQERLVVEGAAAVGIAAVLDRALPAERIARGPLVLVVTG 314 Lambda K H 0.313 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 343 Length adjustment: 29 Effective length of query: 325 Effective length of database: 314 Effective search space: 102050 Effective search space used: 102050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory