Align Shikimate kinase; SK; EC 2.7.1.71 (uncharacterized)
to candidate WP_013258658.1 DEBA_RS09240 shikimate kinase
Query= curated2:Q67N09 (174 letters) >NCBI__GCF_000143965.1:WP_013258658.1 Length = 176 Score = 95.9 bits (237), Expect = 3e-25 Identities = 62/168 (36%), Positives = 85/168 (50%), Gaps = 4/168 (2%) Query: 2 NIVLVGLMGSGKTAVGRLLAERLGRPFVDTDRLVEADAGRTVADIFAAEGEEGFRRREAE 61 NI L+G+ G GK+ +GR LA RLG F+D D L+E AG + I A +GEEGF+ E Sbjct: 11 NICLIGMAGVGKSYLGRRLAARLGWTFLDVDELMEKRAGMGLQQIVAQKGEEGFKALEER 70 Query: 62 VVARAAAGDNQVIATGGGAVLRTENREALRRTGFVIWLDAEPETLYDRARGQGLHRRPLL 121 + V+ATGG AV + LR G V++L +P + AR L R ++ Sbjct: 71 TILGLTDLRRHVVATGGSAVYSAKAMGHLRAIGHVVYLHDQPANI--AARVDNLPTRAVI 128 Query: 122 SGPDPLGRLRALAAARRPFYAQAAHVRICTDRRSLQDVVAEIMEKLQE 169 D G L L ARRP Y AAH+R+ D + +E L + Sbjct: 129 GLGD--GSLERLFTARRPLYEAAAHLRLDLDGPGGAEATLAALEALAQ 174 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 79 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 174 Length of database: 176 Length adjustment: 19 Effective length of query: 155 Effective length of database: 157 Effective search space: 24335 Effective search space used: 24335 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory