Align UPF0280 protein MA_1715 (characterized, see rationale)
to candidate WP_013258117.1 DEBA_RS06465 UPF0280 family protein
Query= uniprot:Y1715_METAC (253 letters) >NCBI__GCF_000143965.1:WP_013258117.1 Length = 242 Score = 137 bits (345), Expect = 2e-37 Identities = 90/217 (41%), Positives = 122/217 (56%), Gaps = 4/217 (1%) Query: 22 QLRETIVTIAADDPAHIEAAKEAIRVHRATLETYILADPYFQFTLEPYECPENAPEVVRR 81 +++ET + I A+ +A E I R LE YI A P F L P + AP +VRR Sbjct: 24 RVKETDLWIMAERDLRAQAV-EIIMALRLGLEAYIRARPEFVDALTPLADDDLAPPLVRR 82 Query: 82 MVKAGNTMGIGPMSAVAGTISALAVEAMVKAGAKYAIVDNGGDIALINDRSVVVGIYAGQ 141 M+ AG G+GPM+AVAG + A A ++ ++ V+NGGD+ L R + +G++AG Sbjct: 83 MLTAGRAAGVGPMAAVAGAM-AQATATALQEHSQAVAVENGGDVYLDAGRDLTIGLFAGA 141 Query: 142 SPIK-NLGLIFEPRDSITGVCTSAGTVGPSISFGMADAAAIFSDDVSLADAAATALGNEV 200 SP+ LGL V TS+GTVG S+S G ADAA I + D +LADAAATALGN V Sbjct: 142 SPLSGRLGLRVAATAQPLAVSTSSGTVGHSLSLGRADAATIIAADAALADAAATALGNRV 201 Query: 201 GIGKEAVEVAFKVVKTVQGIKGALVIQGEYIGMWGKV 237 + + A + V G+ GAL I G I WG+V Sbjct: 202 RAAAD-LRPALEWAAGVHGVLGALAIIGGDIAAWGQV 237 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 253 Length of database: 242 Length adjustment: 24 Effective length of query: 229 Effective length of database: 218 Effective search space: 49922 Effective search space used: 49922 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory