Align [corrinoid iron-sulfur protein]-dependent methionine synthase (characterized)
to candidate WP_043814317.1 DEBA_RS11000 hypothetical protein
Query= metacyc::MONOMER-21502 (342 letters) >NCBI__GCF_000143965.1:WP_043814317.1 Length = 344 Score = 197 bits (500), Expect = 4e-55 Identities = 117/344 (34%), Positives = 174/344 (50%), Gaps = 14/344 (4%) Query: 9 LPTMIGSMPHTDPKAAVDIITHYLQDIPVWPQLPRRSCLEGMSAQFSQGLP---GVKINQ 65 + T IGS+PH DP AV +T L ++P WPQLP E M+ Q+ L G + Sbjct: 1 MATGIGSLPHRDPLTAVADVTGRLTEMPYWPQLPALGPAEDMNLQYVAALEPLVGADLAS 60 Query: 66 DKVWIEPNPSFESELESLYQAYLDNDFNKFPIGAEYAAGLYEL-----ASRNLSPLLVKG 120 + P E L LY+ D F A+ AAG A+ S VKG Sbjct: 61 REPKAHPGLGREEALAGLYERLFGGDTAGFTPRADQAAGFAPFCRVIAAAPTASFPWVKG 120 Query: 121 HITGPLTYCMSIKDPSGKDILYDEVLSDAATKLLKLKATWQEHFLRNICRNTIIFVDEPA 180 H+TGPLT ++ GK +LYD+ ++A + L + Q L + R ++F+DEP Sbjct: 121 HVTGPLTQAAAVLGHDGKAMLYDDECAEAVARALGVALAAQAGQLAALGRRVMMFLDEPF 180 Query: 181 MSAYGSAYLPLSREQVTGMFDEVFSGISG-----LKGVHCCGNTDWSILMDTRVDIINFD 235 +S YGSA+ P++R++V + + G+HCCGNTDW++L++ D++N D Sbjct: 181 LSGYGSAFTPINRQRVVDLLAACLEEARQRAPWVVIGIHCCGNTDWAMLVEAGADVLNLD 240 Query: 236 TYAYANSLSIYTDEVKAFIKRGGAVAWGIVPTDEKALKEETAASLKDRLEAAMSHFDSHG 295 + + L +Y + ++A +RGGAVAWG VPT E ET L ++ ++ G Sbjct: 241 SAGFGRHLLLYPEALRALFQRGGAVAWGAVPTSEYT-GRETVEGLWAHTRDLLTQLEAMG 299 Query: 296 LPFAELARHSLITPACGLGLKSPEAAERAPQLLAELSALLRRKH 339 A+LA +++TPACGLG A L A +SAL RR + Sbjct: 300 FERAQLAAQAMVTPACGLGSLDEARARAILDLTAGVSALARRDY 343 Lambda K H 0.319 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 344 Length adjustment: 29 Effective length of query: 313 Effective length of database: 315 Effective search space: 98595 Effective search space used: 98595 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory