Align fused D-3-phosphoglycerate dehydrogenase / phosphoserine phosphatase (EC 1.1.1.95; EC 3.1.3.3) (characterized)
to candidate WP_013257549.1 DEBA_RS03615 hydroxyacid dehydrogenase
Query= reanno::Cola:Echvi_2777 (630 letters) >NCBI__GCF_000143965.1:WP_013257549.1 Length = 316 Score = 189 bits (480), Expect = 2e-52 Identities = 117/320 (36%), Positives = 170/320 (53%), Gaps = 9/320 (2%) Query: 233 INVLLLENVHPIGVEIMKQEGYNVEVVSSAMSEEELCEKIKNVSIIGIRSKTQITKKVLE 292 + +L+ + +H GVEI K EG+ VEV + + E L + V + IRS T++T ++L Sbjct: 1 MKILVSDPLHEKGVEIFKNEGFEVEV-KTGLDPEALKAAMAGVDGLVIRSATKVTAELLA 59 Query: 293 NANRLMAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIFLMRNLHDKT 352 A+ L VG G + +D+ C KG+ V N P N+ + ELA+ I + R++ Sbjct: 60 AADSLKVVGRAGTGLDNVDIPACTAKGVIVMNTPGQNSNAAAELAMGHIFAVSRHIGRGN 119 Query: 353 LKMHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYD---IVERLAL 409 + QG W K E++GK LGIIG GNIG L+ LA M+V +D E + Sbjct: 120 AGVKQGKWEKKQLRGRELKGKTLGIIGLGNIGRILAELATGCKMSVLGFDPFMDAEAIKA 179 Query: 410 GNATKIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGHVVDVPA 469 A + S D+LL D +S+HV + + N KMK GAIL+N +RG +V Sbjct: 180 RGAEPV-SFDDLLARSDYVSIHVPKTKQTAGLFNAATFAKMKDGAILINCARGGIVVEED 238 Query: 470 LRDALESGHLAGAAVDVFPTEPKNNDEPFESELIGCPNTILTPHIGGSTLEAQENIAQFV 529 L ALE G LAGAA+DVF EP P S L+ + + TPH+G +T EAQEN+A V Sbjct: 239 LCAALEQGKLAGAALDVFEVEPL----PANSRLLYADDVVCTPHLGANTYEAQENVAVAV 294 Query: 530 PGKIIEYINSGNTFNSVNFP 549 ++ ++ G +VN P Sbjct: 295 ANQMSRFLKGGPAEFAVNAP 314 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 630 Length of database: 316 Length adjustment: 32 Effective length of query: 598 Effective length of database: 284 Effective search space: 169832 Effective search space used: 169832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory