Align branched-chain amino acid aminotransferase subunit (EC 2.6.1.6; EC 2.6.1.42) (characterized)
to candidate WP_013259975.1 DEBA_RS15920 aminodeoxychorismate synthase, component I
Query= metacyc::MONOMER-11904 (286 letters) >NCBI__GCF_000143965.1:WP_013259975.1 Length = 754 Score = 90.9 bits (224), Expect = 8e-23 Identities = 77/260 (29%), Positives = 119/260 (45%), Gaps = 12/260 (4%) Query: 3 IYLNGEFVEKEQAKISVYDHGLLYGDGVFEGIRVYDGVIFKLKEHIDRLFDSATSLQMDI 62 ++LNG +A++ D GLL+GDG FE IR+ DG L H+ R + +L D Sbjct: 480 VWLNGLLSPAVRARVHADDRGLLWGDGFFETIRLQDGQAPLLARHLARWERAWQAL--DF 537 Query: 63 QTSKDEISKIVID-TIRINELNNAYIRLVITRGVGDLGLDPRKCP--KPTIFCIAEPMNP 119 D VID + N L + I G L P P +PT+ A P P Sbjct: 538 GPVPDLTWPQVIDQVLAANGLERGLAAVKILATRGRLAQTPALGPTTRPTLLVTARPYAP 597 Query: 120 LLGEDGIKVIT-SSIRRLPVDVLNPAVKSLNYLNSILAKIQANYAGCDEAFLLDSEGYVA 178 G DG+++IT R+ P+ A K+ NYL +LA A AG DEA +L+ +G V+ Sbjct: 598 -RGADGLRLITYPQPRQSPL----AAHKTTNYLYYLLAGRHAAQAGADEALILNPDGGVS 652 Query: 179 EGTGDNIFVIKNGKIKTPPVSSSVLKGITRDAVVDLAKEQGYEIIEEKLTLHDLYVADEL 238 E T ++ G+ P S VL G+ + +++ GY+ + + +L AD+L Sbjct: 653 E-TNSACLIVIEGRRAVAPSSPHVLAGVMQQRLLEELSAWGYQTLWRAIRPEELLRADQL 711 Query: 239 FITGTAAELAHVVEIDGRVI 258 + + +DG + Sbjct: 712 IVANALIGPCPALSLDGAAL 731 Lambda K H 0.319 0.140 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 754 Length adjustment: 33 Effective length of query: 253 Effective length of database: 721 Effective search space: 182413 Effective search space used: 182413 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory