Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_041789204.1 RVAN_RS13280 D-glycerate dehydrogenase
Query= BRENDA::Q9LT69 (588 letters) >NCBI__GCF_000166055.1:WP_041789204.1 Length = 320 Score = 135 bits (339), Expect = 3e-36 Identities = 97/321 (30%), Positives = 153/321 (47%), Gaps = 13/321 (4%) Query: 46 KPTILVTEKLGQAGIDLLKKYANVDCS---YDLSLEELCTKISLCDALIVRSGTKVGRDV 102 KP +L+T L A ID ++ ++D + + EEL + + DAL+V + DV Sbjct: 3 KPKLLMTRVLSPATIDRARRDYDLDLNEADVPFTPEELIARAAGKDALLVTLADRFSADV 62 Query: 103 FESSRGRLKVVGRAGVGIDNVDLAAATEYGCLVVNAPTANTVAAAEHGIALLTAMARNIA 162 +KV+ VG +++DL AA G V P A TVA AE G L+ AR + Sbjct: 63 IAKLDRSVKVIATYSVGHEHIDLQAAKARGIRVAYTPDAVTVATAEIGFLLILGAARRAS 122 Query: 163 QADASIKAGK---WTRNKYVGVSLVGKTLAVLGFGKVGSEVARRARGLGM--HVITHDP- 216 + + ++A W + +G L GK L + G GK+G +A+RARG M H P Sbjct: 123 EGERLLRAKAWHGWQPMQLIGRRLDGKKLGIYGMGKIGQAIAKRARGFDMDIHYFNRRPL 182 Query: 217 YAPADRARAIGVELVSFEVAISTADFISLHLPLTAATSKMMNDVTFAMMKKGVRIVNVAR 276 A A R L S ++ D + + P T T ++ A +K G + N+AR Sbjct: 183 VAAAARGATYHATLDSL---LAVTDILCIAAPSTPETRGSIDAAALAKLKPGAIVTNIAR 239 Query: 277 GGVIDEEALLRALDSGIVAQAALDVFTVEPPVKDNKLVLHESVTATPHLGASTMEAQEGV 336 G ++ + L+ A+ SG +A LDV+T EP + L E+ PH+G S +EA++ + Sbjct: 240 GDLVVDGDLIAAVKSGHIAHIGLDVYTNEPNIHPGYYDL-ENAFLLPHMGTSVIEARDEM 298 Query: 337 SIEVAEAVIGALRGELAATAV 357 + + + L G TA+ Sbjct: 299 GRDALDNIDAVLAGREPPTAL 319 Lambda K H 0.317 0.133 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 588 Length of database: 320 Length adjustment: 32 Effective length of query: 556 Effective length of database: 288 Effective search space: 160128 Effective search space used: 160128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory