Align Phosphoserine aminotransferase; Phosphohydroxythreonine aminotransferase; PSAT; EC 2.6.1.52 (characterized)
to candidate WP_013420529.1 RVAN_RS14850 phosphoserine transaminase
Query= SwissProt::P52878 (370 letters) >NCBI__GCF_000166055.1:WP_013420529.1 Length = 386 Score = 498 bits (1283), Expect = e-146 Identities = 239/373 (64%), Positives = 283/373 (75%), Gaps = 8/373 (2%) Query: 2 KPTRVPNNPCFSSGPCAKHPGYSIEELKDTPFGRSHRSNLGKEKLAEAIKKTRDMLGLPD 61 KP PN FSSGPCAK PGYS++ LK GRSHRS GK KL AI KTR +LG+P Sbjct: 5 KPAARPNVAHFSSGPCAKRPGYSLDNLKTAELGRSHRSKPGKAKLKLAIDKTRAILGVPQ 64 Query: 62 DYLVGIVPASDTGAFEMCLWSMLGCRGVDVLVWESFSKGWATDITKQLKLKDVRVFEAEY 121 DYL+GIV ASDTGAFEM +WS LG RG+DV WESF K W TDITKQLKLKDVRVF+A Y Sbjct: 65 DYLIGIVAASDTGAFEMAMWSALGARGIDVFAWESFGKDWVTDITKQLKLKDVRVFDAPY 124 Query: 122 GKLPDLKKVDFKNDVVFVWNGTTSGVKVPNGDWIPENREGLTLCDATSAIFAMDIPYHKL 181 G+LPDL + DF+NDVVF WNGTTSGV+VP+GD+IP+NREGLT CDATSA FA ++ + KL Sbjct: 125 GELPDLGQADFRNDVVFTWNGTTSGVRVPSGDFIPDNREGLTFCDATSAAFAQELDWAKL 184 Query: 182 DVITFSWQKVLGGEGAHGMLILSPRAVQRLESYTPAWPLPKIFRLTKGGKLNKKIFEGST 241 DV+TFSWQKVLGGE HG+LILSPRAV+RLESYTPAWP+PK+FR+TKGGKLN++IF+GST Sbjct: 185 DVVTFSWQKVLGGEAQHGILILSPRAVERLESYTPAWPMPKLFRMTKGGKLNREIFDGST 244 Query: 242 INTPSMLANEDWLATLKWAESVGGLKPLIQRTNDNLAVFEAFVAKNNWIHFLAETKEIRS 301 INTPSML ED+L L WAE +GGL L R+N N V +V K W+ FLA RS Sbjct: 245 INTPSMLCVEDYLDALNWAEGLGGLTALQARSNANFKVLADWVEKTPWVDFLASVPSTRS 304 Query: 302 STSVCFKV--------DLSDEKLKELIKTLEKEKVAYDIGSYRDAPSGLRIWCGATVEKE 353 +TSVC K+ + K++ TLEKE VA DIG+YRDAP+GLRIW GAT+E Sbjct: 305 NTSVCLKIVDPEIATPEAQAAVAKDIASTLEKEGVALDIGAYRDAPAGLRIWAGATIEAS 364 Query: 354 DLQCLCEWIEWAY 366 DL+ L W++WA+ Sbjct: 365 DLEALVPWLDWAF 377 Lambda K H 0.318 0.136 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 549 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 370 Length of database: 386 Length adjustment: 30 Effective length of query: 340 Effective length of database: 356 Effective search space: 121040 Effective search space used: 121040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_013420529.1 RVAN_RS14850 (phosphoserine transaminase)
to HMM TIGR01365 (phosphoserine aminotransferase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01365.hmm # target sequence database: /tmp/gapView.23122.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01365 [M=374] Accession: TIGR01365 Description: serC_2: phosphoserine aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-210 685.4 0.6 1.2e-210 685.2 0.6 1.0 1 lcl|NCBI__GCF_000166055.1:WP_013420529.1 RVAN_RS14850 phosphoserine trans Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000166055.1:WP_013420529.1 RVAN_RS14850 phosphoserine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 685.2 0.6 1.2e-210 1.2e-210 1 373 [. 9 379 .. 9 380 .. 0.99 Alignments for each domain: == domain 1 score: 685.2 bits; conditional E-value: 1.2e-210 TIGR01365 1 rpanpefssgpcakrpgysveelknaalgrshrsklgkeklkeaiektrevlevpadyligivaasdtg 69 rp+ +fssgpcakrpgys+++lk a lgrshrsk gk+klk ai+ktr +l+vp+dyligivaasdtg lcl|NCBI__GCF_000166055.1:WP_013420529.1 9 RPNVAHFSSGPCAKRPGYSLDNLKTAELGRSHRSKPGKAKLKLAIDKTRAILGVPQDYLIGIVAASDTG 77 79999**************************************************************** PP TIGR01365 70 avemalwsllgargvdllafesfgkgwvtdvtkqlklkdvrvleaeygklpdlkkvdfkkdvvftwngt 138 a+ema+ws lgarg+d++a+esfgk+wvtd+tkqlklkdvrv++a+yg+lpdl + df +dvvftwngt lcl|NCBI__GCF_000166055.1:WP_013420529.1 78 AFEMAMWSALGARGIDVFAWESFGKDWVTDITKQLKLKDVRVFDAPYGELPDLGQADFRNDVVFTWNGT 146 ********************************************************************* PP TIGR01365 139 tsgvrvpngdfipadreglticdatsaafaqdldyekldvvtfswqkvlggegahgvlilspravarle 207 tsgvrvp gdfip++reglt+cdatsaafaq+ld+ kldvvtfswqkvlgge hg+lilsprav+rle lcl|NCBI__GCF_000166055.1:WP_013420529.1 147 TSGVRVPSGDFIPDNREGLTFCDATSAAFAQELDWAKLDVVTFSWQKVLGGEAQHGILILSPRAVERLE 215 ********************************************************************* PP TIGR01365 208 sytpawplpkifrltkggklskdifegetintpsmlavedaldalkwaesigglkalvaraddnlavle 276 sytpawp+pk+fr+tkggkl+++if+g+tintpsml+ved+ldal+wae +ggl al+ar+++n +vl+ lcl|NCBI__GCF_000166055.1:WP_013420529.1 216 SYTPAWPMPKLFRMTKGGKLNREIFDGSTINTPSMLCVEDYLDALNWAEGLGGLTALQARSNANFKVLA 284 ********************************************************************* PP TIGR01365 277 afvaksswvdflaatkeirsntsvclkvvdpdvaaldedaqadfakelvsalekegvaydigsyrdapa 345 ++v+k++wvdfla + +rsntsvclk+vdp++a+ +aqa +ak+++s+lekegva+dig+yrdapa lcl|NCBI__GCF_000166055.1:WP_013420529.1 285 DWVEKTPWVDFLASVPSTRSNTSVCLKIVDPEIATP--EAQAAVAKDIASTLEKEGVALDIGAYRDAPA 351 ********************************9865..458**************************** PP TIGR01365 346 glriwcgatveksdleallewldwafal 373 glriw gat+e+sdleal++wldwafa lcl|NCBI__GCF_000166055.1:WP_013420529.1 352 GLRIWAGATIEASDLEALVPWLDWAFAN 379 **************************85 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (374 nodes) Target sequences: 1 (386 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.56 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory