Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate WP_007474112.1 CMTB2_RS03790 phosphoserine phosphatase SerB
Query= SwissProt::Q7M7U5 (206 letters) >NCBI__GCF_000170735.1:WP_007474112.1 Length = 206 Score = 252 bits (643), Expect = 4e-72 Identities = 132/203 (65%), Positives = 156/203 (76%) Query: 1 MKLAVFDFDSTLMDGETIDILAHHYGVGEEVDRITKGAMEGGLDFYESLKRRVALLRGME 60 MKLAVFDFDSTLMDGETID LA G ++V IT+ AM G LDF+ESL RV LL G+E Sbjct: 1 MKLAVFDFDSTLMDGETIDFLAEPLGFKDKVASITEMAMRGELDFFESLIMRVKLLEGLE 60 Query: 61 LSLVEEICANLTLMEGAKELIQELKRRDYKVVVFSGGFKNATSKARETLGLDADFSNILH 120 V EIC NL M GA E I+ LK+ YKVVVFSGGF+NATS A+E LG DADFSNILH Sbjct: 61 DKKVNEICHNLPYMPGADETIKALKKDGYKVVVFSGGFRNATSYAKEILGFDADFSNILH 120 Query: 121 HKEGKLTGEVGGEMMFGSSKGEMMQTLQRLLGISPELTMAVGDGANDASMFPFAKQRVAF 180 K G+LTG VGGEMMF SKG+M++ LQ +LGIS E T+ VGDGAND SMF +A R+AF Sbjct: 121 SKNGRLTGLVGGEMMFSHSKGDMLKRLQAILGISIEDTLVVGDGANDLSMFKYAGTRIAF 180 Query: 181 CAKPILREKANIIIEKKDLREIL 203 CAK +L+++AN+IIE+KDL +IL Sbjct: 181 CAKDVLKKEANVIIEEKDLTKIL 203 Lambda K H 0.320 0.137 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 206 Length of database: 206 Length adjustment: 21 Effective length of query: 185 Effective length of database: 185 Effective search space: 34225 Effective search space used: 34225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate WP_007474112.1 CMTB2_RS03790 (phosphoserine phosphatase SerB)
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00338.hmm # target sequence database: /tmp/gapView.31282.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00338 [M=219] Accession: TIGR00338 Description: serB: phosphoserine phosphatase SerB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-77 246.2 1.3 1.6e-77 246.0 1.3 1.0 1 lcl|NCBI__GCF_000170735.1:WP_007474112.1 CMTB2_RS03790 phosphoserine phos Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000170735.1:WP_007474112.1 CMTB2_RS03790 phosphoserine phosphatase SerB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 246.0 1.3 1.6e-77 1.6e-77 15 219 .] 2 206 .] 1 206 [] 0.99 Alignments for each domain: == domain 1 score: 246.0 bits; conditional E-value: 1.6e-77 TIGR00338 15 klvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslreRvkllkglpvellkkveek 83 kl+vfD+Dstl++ E+Id +a G +++V+ iTe AmrgeldF esl Rvkll gl+ +++++++++ lcl|NCBI__GCF_000170735.1:WP_007474112.1 2 KLAVFDFDSTLMDGETIDFLAEPLGFKDKVASITEMAMRGELDFFESLIMRVKLLEGLEDKKVNEICHN 70 89******************************************************************* PP TIGR00338 84 lelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaNrLevedgkltGkvegeivdesa 152 l+ ++G+ e++k+Lk+ gykv+v+SGgF+ ++ + ke Lg da f+N L+ ++g+ltG v ge++ +++ lcl|NCBI__GCF_000170735.1:WP_007474112.1 71 LPYMPGADETIKALKKDGYKVVVFSGGFRNATSYAKEILGFDADFSNILHSKNGRLTGLVGGEMMFSHS 139 ********************************************************************* PP TIGR00338 153 kaktllkllekegislektvavGDGanDlsmikaAglgiafnakpvlkekadiviekkdltdilell 219 k+++l++l+ gis+e+t++vGDGanDlsm+k Ag iaf+ak vlk++a++ ie+kdlt+ile++ lcl|NCBI__GCF_000170735.1:WP_007474112.1 140 KGDMLKRLQAILGISIEDTLVVGDGANDLSMFKYAGTRIAFCAKDVLKKEANVIIEEKDLTKILEFI 206 ***************************************************************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (219 nodes) Target sequences: 1 (206 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.36 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory