Align 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (characterized)
to candidate WP_013459745.1 SULKU_RS04475 3-phosphoshikimate 1-carboxyvinyltransferase
Query= BRENDA::F5A7Q0 (429 letters) >NCBI__GCF_000183725.1:WP_013459745.1 Length = 425 Score = 323 bits (828), Expect = 6e-93 Identities = 184/414 (44%), Positives = 250/414 (60%), Gaps = 13/414 (3%) Query: 19 IPGDKSISHRAVMFGSIAEGKTTIKGFLSGADCLSTISCFKEMGVEITQNGDEVTVVGKG 78 I DKSISHR MF +AEG++ ++ FL D L+T+ +G +I +G+ +T+ G Sbjct: 19 IAPDKSISHRCAMFAVLAEGESRVENFLRAEDTLNTLKIVGHLGAQIHDDGEVITIRSNG 78 Query: 79 LEGLQEPKAVLDVGNSGTTIRLMSGILANTPFFSCVQGDESIAKRPMKRVTNPLKQMGAN 138 + QE +LD GNSGT +RL G+L++ + GDE + +RPMKRVT PL+ +GA Sbjct: 79 I---QETSEILDCGNSGTGMRLFCGLLSSAEGHFVLTGDEYLKRRPMKRVTQPLRSIGAK 135 Query: 139 IDGREEGTFTPLTIRGGDLKAIEYISPVASAQVKSAILLAGLRAEGVTAVTEPHISRDHT 198 +DGR G PL+IRG LKA +Y+SP+ASAQVKSA++LA LR++GV EP +SRDHT Sbjct: 136 LDGRNNGDLAPLSIRGASLKAFDYVSPIASAQVKSAMMLAALRSDGVCTFREPELSRDHT 195 Query: 199 ERMLEAFGVKVTREGKTVKLSGGQ-KLTATNIQVPGDVSSAAFFLVAGAIIPNSKLVLQN 257 ERML G +V G K+ + L NI+VP D SSA FF VA AI PNS +++ Sbjct: 196 ERMLRGMGARVEINGLETKIWPLEAPLKPLNIRVPADPSSAFFFAVAAAITPNSSTLIEG 255 Query: 258 VGMNPTRTGIIDVLEKMGATFTVDLINEGASEPAANITIETSSLKGIEIGGDIIPRLIDE 317 V +NPTR VLE+MGA T L N+ EP I +E + L + + + I LIDE Sbjct: 256 VTLNPTRIEAFKVLERMGAKITYTL-NDERYEPIGTIRVEHAPLHAVTV-EENIAWLIDE 313 Query: 318 IPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDGMIIYGKSAL 377 +P +++A AEG ++IK+A EL+VKE++RI TVV L G E DG + G L Sbjct: 314 LPALSIAMACAEGKSIIKNAEELRVKESDRIKTVVDNLNLCGIETEEYPDGYAVIG-GEL 372 Query: 378 KGNTVNSYGDHRIGMMLAIAG--CLAEGKTIIEDAEAVGVSYPTFFDELQKLAK 429 K VNS+GDHRI M I G C E +ED E + S+P FF+ L+ K Sbjct: 373 KSARVNSFGDHRIAMSFLIGGLKCGME----VEDIECINTSFPNFFELLEMCTK 422 Lambda K H 0.315 0.134 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 429 Length of database: 425 Length adjustment: 32 Effective length of query: 397 Effective length of database: 393 Effective search space: 156021 Effective search space used: 156021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (24.3 bits)
Align candidate WP_013459745.1 SULKU_RS04475 (3-phosphoshikimate 1-carboxyvinyltransferase)
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.14964.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-128 413.0 0.0 7.7e-128 412.7 0.0 1.0 1 lcl|NCBI__GCF_000183725.1:WP_013459745.1 SULKU_RS04475 3-phosphoshikimate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000183725.1:WP_013459745.1 SULKU_RS04475 3-phosphoshikimate 1-carboxyvinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 412.7 0.0 7.7e-128 7.7e-128 5 412 .. 19 420 .. 17 423 .. 0.95 Alignments for each domain: == domain 1 score: 412.7 bits; conditional E-value: 7.7e-128 TIGR01356 5 ipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakveeekeelviegvgglkepeael 73 i+++KSishR ++a Laege++v+n+L++eDtl+tl+++ +lGa++++++e+++i+ +g ++e +++l lcl|NCBI__GCF_000183725.1:WP_013459745.1 19 IAPDKSISHRCAMFAVLAEGESRVENFLRAEDTLNTLKIVGHLGAQIHDDGEVITIRSNG-IQETSEIL 86 78********************************************************98.7******* PP TIGR01356 74 dlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgaeieskeeegslPlaisgplkg 142 d+gnsGt +Rl g+l+ a+g++vltgde lk+RP++r++++Lr++ga+ + +++ + +Pl+i+g + lcl|NCBI__GCF_000183725.1:WP_013459745.1 87 DCGNSGTGMRLFCGLLSSAEGHFVLTGDEYLKRRPMKRVTQPLRSIGAKLDGRNNGDLAPLSIRGASLK 155 *****************************************************************7666 PP TIGR01356 143 givelsgsaSsQyksalllaaplalqavtleivgeklisrpyieitLkllksfgveveeederkivvkg 211 + ++s+ aS+Q+ksa++laa l+ +++ + e+++sr+++e++L +++ ve + ++ + + lcl|NCBI__GCF_000183725.1:WP_013459745.1 156 AFDYVSPIASAQVKSAMMLAA---LRSDGVCTFREPELSRDHTERMLRGMGAR---VEINGLETKIWPL 218 *********************...78899999999***************988...6666555566666 PP TIGR01356 212 gqkykqkevevegDaSsAafflaaaaitge.evtvenlgenstqgdkaiiivLeemGadveveeqr... 276 ++ k+ +++v++D+SsA+ff++aaait++ + +e+++ n+t+ + ++ vLe+mGa+++++ ++ lcl|NCBI__GCF_000183725.1:WP_013459745.1 219 EAPLKPLNIRVPADPSSAFFFAVAAAITPNsSTLIEGVTLNPTRIE--AFKVLERMGAKITYTLNDery 285 66688889**********************99**************..677***********998889* PP TIGR01356 277 ....dvevegasklkgvkvdidvdsliDelptlavlaafAegetriknieelRvkEsdRiaaiaeeLek 341 +++ve+ l++v+v+++++ liDelp+l++++a+Aeg++ ikn+eelRvkEsdRi+ ++++L+ lcl|NCBI__GCF_000183725.1:WP_013459745.1 286 epigTIRVEH-APLHAVTVEENIAWLIDELPALSIAMACAEGKSIIKNAEELRVKESDRIKTVVDNLNL 353 *********5.68******************************************************** PP TIGR01356 342 lGveveeledgllieGkkkelkgavvdtydDHRiamalavlglaaegeveiedaecvaksfPeFfevle 410 G+e+ee +dg + G+ elk+a+v++++DHRiam++ + gl++ +e+ed ec+++sfP+Ffe+le lcl|NCBI__GCF_000183725.1:WP_013459745.1 354 CGIETEEYPDGYAVIGG--ELKSARVNSFGDHRIAMSFLIGGLKCG--MEVEDIECINTSFPNFFELLE 418 *****************..7*************************6..*******************99 PP TIGR01356 411 ql 412 lcl|NCBI__GCF_000183725.1:WP_013459745.1 419 MC 420 76 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (425 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 10.79 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory