Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_013459654.1 SULKU_RS04030 homoserine O-acetyltransferase
Query= SwissProt::E0UR96 (368 letters) >NCBI__GCF_000183725.1:WP_013459654.1 Length = 365 Score = 590 bits (1522), Expect = e-173 Identities = 270/364 (74%), Positives = 320/364 (87%) Query: 3 LNLQTYTEHFTNPLYLESGRILEPYDITYETYGTMNEDKSNVVVVCHALTGSHHAAGLYE 62 LNLQ ++EHFTNPLYLESGRILEPYDI YETYG +NE + NV+V+CHALTGSHHAAG YE Sbjct: 2 LNLQIHSEHFTNPLYLESGRILEPYDIVYETYGELNEARDNVIVICHALTGSHHAAGTYE 61 Query: 63 DETKPGWWDGFIGSGKAIDTDKYFVICSNVIGSCFGSTGPMSLQHPYQEPYRYKFPVVSI 122 + KPGWWDG IG GKA+DTD++FVIC+NVIGSCFGSTGPMSL++PY +PYRYKFPV++I Sbjct: 62 GDNKPGWWDGLIGQGKAVDTDRFFVICTNVIGSCFGSTGPMSLRYPYNDPYRYKFPVITI 121 Query: 123 KDMVKAQRILFDRLDIHRVHAIVGGSMGGMQALQFAIHYPNFANKIIALATTHATQPWAI 182 DMVKAQRILFDRL IH+VHA++GGSMGGMQAL F + +PNFA KIIA+ATT ATQPWAI Sbjct: 122 LDMVKAQRILFDRLGIHQVHAVIGGSMGGMQALAFGVFFPNFAKKIIAMATTAATQPWAI 181 Query: 183 AFNKVAQESILNDPDFKQGYYDPDLLKEQGLSGMAVGRMAGHISFLSHESMREKFGRDYK 242 AFNKVAQE+IL DP+FK GYYDP++++E GLSGMA+GRMAGHISFLSH+SM +KFGR+YK Sbjct: 182 AFNKVAQEAILKDPEFKNGYYDPEVIRENGLSGMAIGRMAGHISFLSHQSMAKKFGREYK 241 Query: 243 LTDGLYELFGKFQVESYLEYNGYNFTKWFDPLAYLYITKAINIYDLSRGFDSLAEALKRV 302 TDGL+ELFGKFQVESYLEYNGYNFTKWFDPL+YLYITKAINIYDLSRGFDS+ EAL ++ Sbjct: 242 RTDGLFELFGKFQVESYLEYNGYNFTKWFDPLSYLYITKAINIYDLSRGFDSIEEALNKI 301 Query: 303 TSALYLVSFKNDLLFKNFEMKEIADELDKIGNKNHSYIDVKSDYGHDAFLVELNKFENHV 362 + LYLV F+ D+LF EM+ I + +G N Y++V SDYGHDAFLVE++K EN+V Sbjct: 302 NAELYLVGFEKDILFLPSEMESIHTAMLAMGKTNSDYLEVVSDYGHDAFLVEIDKIENYV 361 Query: 363 KDAL 366 ++AL Sbjct: 362 REAL 365 Lambda K H 0.320 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 604 Number of extensions: 29 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 365 Length adjustment: 30 Effective length of query: 338 Effective length of database: 335 Effective search space: 113230 Effective search space used: 113230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_013459654.1 SULKU_RS04030 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.25940.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-128 413.2 0.0 4.9e-128 413.0 0.0 1.0 1 lcl|NCBI__GCF_000183725.1:WP_013459654.1 SULKU_RS04030 homoserine O-acety Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000183725.1:WP_013459654.1 SULKU_RS04030 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 413.0 0.0 4.9e-128 4.9e-128 3 349 .. 13 364 .. 11 365 .] 0.96 Alignments for each domain: == domain 1 score: 413.0 bits; conditional E-value: 4.9e-128 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk.GWWdellGpgraldt 70 ++l+lesG +l+ ++++y+tyG+ln++rdN++++cHaltgs+h+ag+++ ++k GWWd l+G+g+a+dt lcl|NCBI__GCF_000183725.1:WP_013459654.1 13 NPLYLESGRILEPYDIVYETYGELNEARDNVIVICHALTGSHHAAGTYEGDNKpGWWDGLIGQGKAVDT 81 789*********************************************998888*************** PP TIGR01392 71 sryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGG 139 +r+fv+c+Nv+Gsc GstgP+s+ ++py+ +fP++ti D+vkaq+ l d+Lg+++++av+GgS+GG lcl|NCBI__GCF_000183725.1:WP_013459654.1 82 DRFFVICTNVIGSCFGSTGPMSLRYPYNDPYRYKFPVITILDMVKAQRILFDRLGIHQVHAVIGGSMGG 150 ************************999****************************************** PP TIGR01392 140 mqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee...qPekGLalAR 205 mqal + ++ p+++kki+++at+a+++++aiafn+v+++ail+Dpe+++G+y+ e + +G+a+ R lcl|NCBI__GCF_000183725.1:WP_013459654.1 151 MQALAFGVFFPNFAKKIIAMATTAATQPWAIAFNKVAQEAILKDPEFKNGYYDPEVireNGLSGMAIGR 219 ****************************************************99864336678999*** PP TIGR01392 206 mlalltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdl 274 m ++++++s++s++++fgre k+++ ++l +f+vesyl+y+g +f + Fd sYl++tka++ +dl lcl|NCBI__GCF_000183725.1:WP_013459654.1 220 MAGHISFLSHQSMAKKFGREYKRTDG-LFELFGKFQVESYLEYNGYNFTKWFDPLSYLYITKAINIYDL 287 *********************99966.667899************************************ PP TIGR01392 275 argrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle...yaeieseeGHDaFlleke 340 +rg ds++eal+ki+a+ +vg+e D+lf ++e e++++a+ a++++ y e+ s++GHDaFl+e + lcl|NCBI__GCF_000183725.1:WP_013459654.1 288 SRG-FDSIEEALNKINAELYLVGFEKDILFLPSEMESIHTAMLAMGKTnsdYLEVVSDYGHDAFLVEID 355 ***.8**********************************999988877788****************** PP TIGR01392 341 kveeliref 349 k+e+ +re lcl|NCBI__GCF_000183725.1:WP_013459654.1 356 KIENYVREA 364 *****9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (365 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.60 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory