Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_013461155.1 SULKU_RS11570 homoserine dehydrogenase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_000183725.1:WP_013461155.1 Length = 419 Score = 193 bits (490), Expect = 2e-53 Identities = 137/423 (32%), Positives = 211/423 (49%), Gaps = 9/423 (2%) Query: 21 RVGIAGLGTVGGSIYRILKERGNEIEKRIGEKFIISKVINRSPQKYELLGVPKEEIAFDF 80 RVG+ G+GTVG ++ +IL+E + I R G++ + + R K L + + +D Sbjct: 3 RVGVIGVGTVGRAVVQILEENKSIITARSGDEISVKSGVVRDLSKVSDLSIAVSQDPYDI 62 Query: 81 DDLILNSDVVVEAIGGTDVAVDLVRRALELGRIVVTPNKNLISEYGNEFSEYIKKRKLFF 140 D D+VVE +GG ++ + +V++AL+ G+ VVT NK L++ + E E F Sbjct: 63 VD-DPEIDIVVELMGGVELPLAVVKKALQNGKAVVTANKALLAYHRYELQEIAGDIPFEF 121 Query: 141 EASVGGGIPIISLLQDYLIFQKVTRIRGIMNGTTNYILTE-MSKGRHFEEVLKEAQELGY 199 EASV GGIPII+ L+D L + I GIMNGT N++LT+ M++G F EVL EAQ LGY Sbjct: 122 EASVAGGIPIINALRDGLSANHILSIMGIMNGTCNFMLTKMMNEGTPFAEVLAEAQALGY 181 Query: 200 AEADPTNDIEGYDVAYKVSVLAGVVTGRFPGINSVQFEGITRIDPEYLKEIVRSGKKLKL 259 AEADPT DI G+D A+K+ +LA + G + EGI I P + G +KL Sbjct: 182 AEADPTFDIGGFDAAHKLLILASIAYGIDAKPEEILIEGIEGITPADIAFAKEFGYTIKL 241 Query: 260 IGELDFSTNRYEVRLR-EVTPEDPFF-NVDGVDNAIEVSTDLAGDFLLKGRGAGGYPTAS 317 +G E+R+ + ED +DGV N I V D G+ L G GAGG TAS Sbjct: 242 LGIAKRDDAEVELRVHAALVKEDAMIAKIDGVMNGISVVGDRVGETLYYGPGAGGNATAS 301 Query: 318 AVIADLFRVAKYKVLGGAEKFSVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVL 377 AV+A++ + + ++ ++ ++ E + K R + KP ++ Sbjct: 302 AVVANIIDIVR-----SGKRSPMLGFNHPLEEGLRLKNSEDIRSKYYLRLRVSDKPGILA 356 Query: 378 SAMGDTTDHLIELAKTIDENPDPRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQL 437 D I + I + LL +T E AL + + A+ + + Sbjct: 357 KITSLFADESISIEAVIQRPSETECAHLLFATHEATERALHGLMAKLETLDAVLESPFMI 416 Query: 438 KII 440 +I+ Sbjct: 417 RIV 419 Score = 28.1 bits (61), Expect = 0.001 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 588 VRAVTFEDGMAKVVLK-DVPDKPGVAARIMRTLSQMGVNIDMIIQGMKSGEYNTVAFIVP 646 +R ED +K L+ V DKPG+ A+I + ++I+ +IQ E + F Sbjct: 330 LRLKNSEDIRSKYYLRLRVSDKPGILAKITSLFADESISIEAVIQRPSETECAHLLFATH 389 Query: 647 ES 648 E+ Sbjct: 390 EA 391 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 721 Number of extensions: 45 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 739 Length of database: 419 Length adjustment: 36 Effective length of query: 703 Effective length of database: 383 Effective search space: 269249 Effective search space used: 269249 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory