Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_013537848.1 THEAM_RS05500 branched-chain amino acid transaminase
Query= BRENDA::F0QW25 (314 letters) >NCBI__GCF_000185805.1:WP_013537848.1 Length = 304 Score = 296 bits (757), Expect = 5e-85 Identities = 147/302 (48%), Positives = 205/302 (67%), Gaps = 2/302 (0%) Query: 15 KYVWVNGKLIPEKEATIPILTHALHYGTSIFEGIRAYWNSDNNNLYVFRARDHYVRFHDS 74 ++ + GK +P +EA I I T++ HYGT++FEGIRAYWN + L+ ++HY R + Sbjct: 3 RFAYFEGKFVPVEEANINIQTNSFHYGTAVFEGIRAYWNEEKKQLFGLFVKEHYERMLAN 62 Query: 75 AKIMSIKVGYSVDELIDATVELLRANDVHEDVYIRPITFVSASTVNLDIRNLDVTTAIIT 134 KI+++KV S EL + TVELLR ED YIRPI + + ++ + AI T Sbjct: 63 CKILNLKVEKSAQELTEITVELLRRCGHREDTYIRPIAYFADLKISPKLIGYKTELAIYT 122 Query: 135 VPFGHYLE-PKGIKAKVVSWLRVHNSMFPMKAKVSGIYVNSVIAIIDAKVSGFDEAILLN 193 VP G YL+ +G+KAK SW R++++M P + KV+G YVNS A +A ++G+DEAI+LN Sbjct: 123 VPLGDYLDLSRGLKAKTASWHRINDTMIPARCKVAGAYVNSAFAKTEALLNGYDEAIMLN 182 Query: 194 RDGYVAEGSGENIFIIKDGILYTPPVYDSILEGITRDTVITIAR-DLGLTVTEKRITREE 252 DG VAEGSGEN+FI+++G L T P +ILEGITR+ VI +AR +LG+ V E+ I R E Sbjct: 183 PDGTVAEGSGENVFIVRNGKLITTPSASNILEGITRNAVIHLAREELGIEVEERPILRSE 242 Query: 253 LYTADEVFFTGTAAEVTPVVNIDGRVIGNGEPGPIALKVRSYYMDVVHGRVSKYKNWLTP 312 LY ADEVF+TGTAA+V PVV +D VIGNGE GP+ +++ Y +V G KY++WLTP Sbjct: 243 LYVADEVFYTGTAAQVAPVVQVDHVVIGNGEVGPVTKRLQEIYFSIVKGNNPKYEHWLTP 302 Query: 313 IY 314 +Y Sbjct: 303 VY 304 Lambda K H 0.321 0.139 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 304 Length adjustment: 27 Effective length of query: 287 Effective length of database: 277 Effective search space: 79499 Effective search space used: 79499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_013537848.1 THEAM_RS05500 (branched-chain amino acid transaminase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.22252.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-114 366.8 0.1 4.4e-114 366.6 0.1 1.0 1 lcl|NCBI__GCF_000185805.1:WP_013537848.1 THEAM_RS05500 branched-chain ami Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000185805.1:WP_013537848.1 THEAM_RS05500 branched-chain amino acid transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 366.6 0.1 4.4e-114 4.4e-114 1 298 [] 6 303 .. 6 303 .. 0.97 Alignments for each domain: == domain 1 score: 366.6 bits; conditional E-value: 4.4e-114 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaif..rlkehveRlydsakilrleipysk 67 +++G++v+ve+a++++ t+++hYGt+vfeGiRaY++++++++f ++keh+eR++ + kil+l+++ s+ lcl|NCBI__GCF_000185805.1:WP_013537848.1 6 YFEGKFVPVEEANINIQTNSFHYGTAVFEGIRAYWNEEKKQLFglFVKEHYERMLANCKILNLKVEKSA 74 89**********************************99888874478********************** PP TIGR01122 68 eelvevtkevlrknnlks.aYiRplvyvGaedlglkpk.vdlkveviiaawewgaylgeealekGikvk 134 +el+e+t+e+lr+ + ++ +YiRp++y + dl+++pk +++k+e++i+++++g yl+ l++G+k+k lcl|NCBI__GCF_000185805.1:WP_013537848.1 75 QELTEITVELLRRCGHREdTYIRPIAY--FADLKISPKlIGYKTELAIYTVPLGDYLD---LSRGLKAK 138 *************998877********..89**************************9...89****** PP TIGR01122 135 vssfrraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPp 203 ++s++r ++ +ip++ k+ag+Y+ns++ak+eal +Gydeai+L+ +G vaeGsGen+fiv++g+l+t p lcl|NCBI__GCF_000185805.1:WP_013537848.1 139 TASWHRINDTMIPARCKVAGAYVNSAFAKTEALLNGYDEAIMLNPDGTVAEGSGENVFIVRNGKLITTP 207 ******************************************************************999 PP TIGR01122 204 vsesiLkgitrdaviklak.elgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGp 271 +++iL+gitr+avi+la+ elgiev+e++i r+ely+aDevf tGtaa v+P+++vD++ ig+g++Gp lcl|NCBI__GCF_000185805.1:WP_013537848.1 208 SASNILEGITRNAVIHLAReELGIEVEERPILRSELYVADEVFYTGTAAQVAPVVQVDHVVIGNGEVGP 276 99****************9789*********************************************** PP TIGR01122 272 vtkklqeaffdlvegktekkeewltyv 298 vtk+lqe +f +v+g+++k+e+wlt+v lcl|NCBI__GCF_000185805.1:WP_013537848.1 277 VTKRLQEIYFSIVKGNNPKYEHWLTPV 303 ************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (304 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.71 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory