Align Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; Asp/Glu-ADT subunit B; EC 6.3.5.- (uncharacterized)
to candidate WP_013555012.1 NITSA_RS10520 glutamine--tRNA ligase/YqeY domain fusion protein
Query= curated2:B5YL60 (475 letters) >NCBI__GCF_000186245.1:WP_013555012.1 Length = 758 Score = 124 bits (311), Expect = 1e-32 Identities = 70/170 (41%), Positives = 102/170 (60%), Gaps = 2/170 (1%) Query: 300 KIERFIKEYGLPQYDSEILTEEKALSEWFEEAVKLGGKPKEVANWIMVELLRLLNEEGKD 359 + ER+ E GL +EIL ++ALS +FE A++ +AN + E+ + + E+G Sbjct: 584 RFERYTGELGLGTTVAEILARDEALSVFFERAMEETEALSTLANLVANEVSKAIKEQG-- 641 Query: 360 INECSLKPIQLVELIELINKGTINRNTAKEVFEEMYKTGKTAEAIVREKGLTQISDDSVI 419 + P Q+ +L +I I+ AKEVFE M + G A V E+GL QISD + I Sbjct: 642 VETLRFTPQQIAQLAGMIEAEEISSKIAKEVFEAMEREGVDPLAYVEERGLRQISDPNQI 701 Query: 420 IEAIKEVMNKNPKEVERFRNGEEKLIGFFVGQVMKITKGKANPKLVNELI 469 + EV+ NP+ VE++R G E+L GFFVGQV+K T GKANP++VNEL+ Sbjct: 702 APIVDEVIAANPENVEKYRAGNERLFGFFVGQVLKATGGKANPRVVNELL 751 Lambda K H 0.317 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 938 Number of extensions: 63 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 475 Length of database: 758 Length adjustment: 37 Effective length of query: 438 Effective length of database: 721 Effective search space: 315798 Effective search space used: 315798 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory