Align 3-dehydroquinate synthase; DHQ synthase; 3-dehydroquinate synthase II; EC 1.4.1.24 (characterized)
to candidate WP_013644951.1 METBO_RS06785 3-dehydroquinate synthase II
Query= SwissProt::Q58646 (361 letters) >NCBI__GCF_000191585.1:WP_013644951.1 Length = 374 Score = 412 bits (1058), Expect = e-119 Identities = 206/377 (54%), Positives = 284/377 (75%), Gaps = 19/377 (5%) Query: 1 MKFGWVNVIGDNWEEKKKIVTTALESSIPVVVAEPEDIEKIKELGNIKVASHSLDADIVL 60 MKF W+ G NW+EKK ++T ALES I +V + ED EKI +LGN+ V S++ D+DI + Sbjct: 1 MKFAWIKAEGQNWDEKKLLITAALESGIDHIV-DYEDPEKIAKLGNLSVVSNTKDSDIHM 59 Query: 61 VNKN----------DNIEFLKEAKNL------GKETAIYIPIESKEDEEFASEVARFGFV 104 V N D++ K+ +L G A Y+ I SK+ EE AS++ + Sbjct: 60 VGINGEGDGTLTIPDDLSNSKDLADLTALKASGSTVAAYMEINSKKHEELASKLGKTA-- 117 Query: 105 DNIILEGRDWTIIPLENLIADLFHRDVKIVASVNSVDEAKVAYEILEKGTDGVLLNPKNL 164 D ++L+G+DWT+IPLEN+IA+L +DVKI+A+V DEAK+A E LE GTDGVLL P ++ Sbjct: 118 DYLVLQGKDWTVIPLENIIAELQGQDVKIIAAVKDFDEAKLALETLEYGTDGVLLIPNDI 177 Query: 165 EDIKELSKLIEEMNKEKVALDVATVTKVEPIGSGDRVCIDTCSLMKIGEGMLIGSYSRAL 224 IK++++ IE+++ E L A VTKVEP+GSGDRVC+DTCS+M++GEGML+GSYS+ L Sbjct: 178 SQIKKVAEFIEKIDSETYQLVAANVTKVEPVGSGDRVCVDTCSMMQVGEGMLVGSYSKGL 237 Query: 225 FLVHSETVENPYVATRPFRVNAGPVHAYILCPGNKTKYLSELKAGDKVLIVDKDGNTREA 284 FLVHSE++E+ YVA+RPFRVNAGPVHAY++ PGNKT+YLSE++ GD+VL VD GNT+ Sbjct: 238 FLVHSESLESEYVASRPFRVNAGPVHAYVMTPGNKTRYLSEIETGDEVLTVDSKGNTKTT 297 Query: 285 IVGRVKIERRPLVLIEAEYKGDIIRTILQNAETIRLVNEKGEPISVVDLKPGDKVLIKPE 344 +VGRVKIE+RPL+L+EAE++G +RT+LQNAETIRL+N+ G+P+SV LK GD+V++ + Sbjct: 298 VVGRVKIEKRPLMLVEAEHEGVSVRTLLQNAETIRLINQDGDPVSVAQLKVGDRVMVYLD 357 Query: 345 EYARHFGMAIKETIIEK 361 + ARHFGMAI+E+IIEK Sbjct: 358 KSARHFGMAIEESIIEK 374 Lambda K H 0.315 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 374 Length adjustment: 30 Effective length of query: 331 Effective length of database: 344 Effective search space: 113864 Effective search space used: 113864 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory