Align Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 (characterized)
to candidate WP_013684774.1 ARCVE_RS10620 aspartate-semialdehyde dehydrogenase
Query= SwissProt::Q57658 (354 letters) >NCBI__GCF_000194625.1:WP_013684774.1 Length = 342 Score = 405 bits (1041), Expect = e-118 Identities = 209/346 (60%), Positives = 264/346 (76%), Gaps = 9/346 (2%) Query: 7 MKIKVGVLGATGSVGQRFVQLLADHPMFELTALAASERSAGKKYKDACYWFQDRDIPENI 66 M+ KV VLGATG VGQ+F+QLL +HP FE++ALAASE+ GK Y + W ++PE + Sbjct: 1 MRFKVAVLGATGMVGQKFIQLLENHPWFEISALAASEKRVGKPYGEEVNWLVSANVPECV 60 Query: 67 KDMVVIPTDPKHEEFEDVDIVFSALPSDLAKKFEPEFAKEGKLIFSNASAYRMEEDVPLV 126 +DM ++P DPKH D DIVFSALPS++A++ E FAKEG ++ SNASA+RMEEDVPLV Sbjct: 61 RDMEMVPMDPKHV---DADIVFSALPSNVAREVEAAFAKEGFVVASNASAFRMEEDVPLV 117 Query: 127 IPEVNADHLELIEIQREKRGWDGAIITNPNCSTICAVITLKPIMDKFGLEAVFIATMQAV 186 IPEVN DHL+L+E Q++KRGWDG I+TNPNC+TI VI+LKP+MD GL+ V +A+MQA+ Sbjct: 118 IPEVNPDHLQLVETQKKKRGWDGFIVTNPNCTTIMLVISLKPLMD-LGLKTVRVASMQAL 176 Query: 187 SGAGYNGVPSMAILDNLIPFIKNEEEKMQTESLKLLGTLKDGKVELANFKISASCNRVAV 246 SGAGY GVPSMAI DN+IPFIK EEEK++TE LKLLG KV A K+SASC+RV V Sbjct: 177 SGAGYPGVPSMAITDNVIPFIKGEEEKVETEPLKLLGKFDGKKVNPAPIKVSASCHRVPV 236 Query: 247 IDGHTESIFVKTKEGAEPEEIKEVMDKFDPLKDLNLPTY-AKPIVIREEIDRPQPRLDRN 305 IDGHTE+++V E ++E + F+ LK L+LPT K I++R E DRPQPRLDR+ Sbjct: 237 IDGHTEAVWV---EFDRDVSVEEAIAAFESLKPLDLPTSPEKVIIVRSEPDRPQPRLDRD 293 Query: 306 EGNGMSIVVGRIRKDPIFDVKYTALEHNTIRGAAGASVLNAEYFVK 351 EGNGMS+VVGR+RKD +KY + HNT+RGAAGAS+LNAE K Sbjct: 294 EGNGMSVVVGRVRKDS-NGLKYIVMGHNTVRGAAGASILNAELMAK 338 Lambda K H 0.317 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 342 Length adjustment: 29 Effective length of query: 325 Effective length of database: 313 Effective search space: 101725 Effective search space used: 101725 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_013684774.1 ARCVE_RS10620 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR00978 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00978.hmm # target sequence database: /tmp/gapView.24701.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00978 [M=342] Accession: TIGR00978 Description: asd_EA: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-154 497.5 0.1 1e-153 497.3 0.1 1.0 1 lcl|NCBI__GCF_000194625.1:WP_013684774.1 ARCVE_RS10620 aspartate-semialde Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000194625.1:WP_013684774.1 ARCVE_RS10620 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 497.3 0.1 1e-153 1e-153 2 341 .. 4 337 .. 3 338 .. 0.99 Alignments for each domain: == domain 1 score: 497.3 bits; conditional E-value: 1e-153 TIGR00978 2 kvavLGatGlvGqklvkllekhpyfelakvvaserkaGkkygevvkwilsgdipeevrdleiketepaa 70 kvavLGatG+vGqk+++lle+hp+fe+ +++ase+++Gk yge v+w +s+++pe vrd+e++ ++p+ lcl|NCBI__GCF_000194625.1:WP_013684774.1 4 KVAVLGATGMVGQKFIQLLENHPWFEISALAASEKRVGKPYGEEVNWLVSANVPECVRDMEMVPMDPK- 71 9******************************************************************9. PP TIGR00978 71 eekdvdlvfsalpsevaeevEkklaeeGlevfsnasalRldpdvplivpEvnsdhlellkvqker.gwk 138 + d+d+vfsalps+va+evE+++a+eG++v+snasa+R+++dvpl++pEvn+dhl+l+++qk++ gw+ lcl|NCBI__GCF_000194625.1:WP_013684774.1 72 -HVDADIVFSALPSNVAREVEAAFAKEGFVVASNASAFRMEEDVPLVIPEVNPDHLQLVETQKKKrGWD 139 .5589*********************************************************9999*** PP TIGR00978 139 GvivtnpnCstailtlalkPlidaasikkvivatlqavsGAGypGvssldildnviPyikgEEekiekE 207 G+ivtnpnC+t++l ++lkPl+ ++k v+va++qa+sGAGypGv+s++i+dnviP+ikgEEek+e+E lcl|NCBI__GCF_000194625.1:WP_013684774.1 140 GFIVTNPNCTTIMLVISLKPLM-DLGLKTVRVASMQALSGAGYPGVPSMAITDNVIPFIKGEEEKVETE 207 **********************.89******************************************** PP TIGR00978 208 tkkilGkleegkvepaelevsatttRvPvleGHtesvfveldkkldieeirealkefkklpqklglpsa 276 ++k+lGk++++kv+pa+++vsa+++RvPv +GHte+v ve+d+++++ee+++a+++ k l +lp+ lcl|NCBI__GCF_000194625.1:WP_013684774.1 208 PLKLLGKFDGKKVNPAPIKVSASCHRVPVIDGHTEAVWVEFDRDVSVEEAIAAFESLKPL----DLPTS 272 *******************************************************99988....9**** PP TIGR00978 277 PekpivlldeedrPqprldldaekgmavtvGrlreeseslklvvlghnlvRGAAGaallnaElly 341 Pek+i+++ e+drPqprld+d ++gm+v+vGr+r++s+ lk++v+ghn+vRGAAGa++lnaEl+ lcl|NCBI__GCF_000194625.1:WP_013684774.1 273 PEKVIIVRSEPDRPQPRLDRDEGNGMSVVVGRVRKDSNGLKYIVMGHNTVRGAAGASILNAELMA 337 ***************************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (342 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.46 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory