Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_013707610.1 DESAC_RS13365 chorismate synthase
Query= SwissProt::P12008 (361 letters) >NCBI__GCF_000195295.1:WP_013707610.1 Length = 353 Score = 361 bits (927), Expect = e-104 Identities = 182/349 (52%), Positives = 242/349 (69%), Gaps = 1/349 (0%) Query: 1 MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60 M+GNT G++FRVTT+GESHG ALG ++DG PP +PLT AD+ +L +RRPG +T RR Sbjct: 1 MSGNTFGRIFRVTTWGESHGPALGAVIDGCPPRLPLTTADIAVELAKRRPGGGLASTTRR 60 Query: 61 EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120 EPD V+ILSGVF TTGT I L+I N D + + Y +K++FRPGH D+TY+ KYG+RDY Sbjct: 61 EPDAVEILSGVFADQTTGTPISLIIYNKDAKIEAYEPLKEIFRPGHGDFTYQAKYGIRDY 120 Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFC 180 RGGGRSSARETA RVAAGA+A+K L + GI + ++G + DW++++QN F+C Sbjct: 121 RGGGRSSARETAARVAAGAVAQKVL-DTGGIRVLAYTLELGGVRAQTFDWTEIDQNQFYC 179 Query: 181 PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV 240 PD + ++ ++ +KK+GDS+G V V G PAGLGEPVFD+LDA +A A+MSI AV Sbjct: 180 PDSEAAASMAARVQDIKKQGDSLGGIVEVRVQGCPAGLGEPVFDKLDAVLAQAVMSIGAV 239 Query: 241 KGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITV 300 KGVEIG GF L GS++ D +T GF SN+AGGIL GIS+G +II A+KP SI Sbjct: 240 KGVEIGAGFAAARLTGSEHNDPLTPKGFVSNNAGGILAGISNGDEIIVRAAVKPIPSIAK 299 Query: 301 PGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRA 349 +TI++ G+ + GRHD R P+ AM+ + L D LLRQ+A Sbjct: 300 LQQTIDQHGQPQTISIAGRHDISAIPRITPVIAAMVKLTLADFLLRQKA 348 Lambda K H 0.319 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 365 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 353 Length adjustment: 29 Effective length of query: 332 Effective length of database: 324 Effective search space: 107568 Effective search space used: 107568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_013707610.1 DESAC_RS13365 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.19109.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-131 422.3 0.1 7.8e-131 422.1 0.1 1.0 1 lcl|NCBI__GCF_000195295.1:WP_013707610.1 DESAC_RS13365 chorismate synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000195295.1:WP_013707610.1 DESAC_RS13365 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 422.1 0.1 7.8e-131 7.8e-131 1 349 [. 10 348 .. 10 350 .. 0.97 Alignments for each domain: == domain 1 score: 422.1 bits; conditional E-value: 7.8e-131 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 +r+tt+GeSHg+alga+idG+P+ l+lt++di+ el++Rrpg + +++r+E D+veilsGvf +TtG lcl|NCBI__GCF_000195295.1:WP_013707610.1 10 FRVTTWGESHGPALGAVIDGCPPRLPLTTADIAVELAKRRPGGGLASTTRREPDAVEILSGVFADQTTG 78 89******************************************************************* PP TIGR00033 70 aPiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLke 138 +Pi+l+i+Nkd + + ye +ke++RPgH d+ty+ KYgi+d++gggrsSaReTaarvaaGava+k L+ lcl|NCBI__GCF_000195295.1:WP_013707610.1 79 TPISLIIYNKDAKIEAYEPLKEIFRPGHGDFTYQAKYGIRDYRGGGRSSARETAARVAAGAVAQKVLDT 147 *******************************************************************99 PP TIGR00033 139 tagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvv 207 gi+++ay+ +lg v++++ ++d++++ cpd ea++ m + ++ +kk+gds+Gg+vev v lcl|NCBI__GCF_000195295.1:WP_013707610.1 148 -GGIRVLAYTLELGGVRAQTFD-----WTEIDQNQFYCPDSEAAASMAARVQDIKKQGDSLGGIVEVRV 210 .99*************999644.....4579************************************** PP TIGR00033 208 snvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGi 276 ++ p+glGep+fdklda la+a++si AvKgveiG+GF+aa+ +Gse+nD+l+ +++nn GGi lcl|NCBI__GCF_000195295.1:WP_013707610.1 211 QGCPAGLGEPVFDKLDAVLAQAVMSIGAVKGVEIGAGFAAARLTGSEHNDPLT----PKGFVSNNAGGI 275 **************************************************985....5579******** PP TIGR00033 277 eGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladall 345 + Gi+nG +i vr+avKpip+i+k ++t+d ++++++ gRhD +++pr++pv+ amv+l+lad ll lcl|NCBI__GCF_000195295.1:WP_013707610.1 276 LAGISNGDEIIVRAAVKPIPSIAKLQQTIDQHGQPQTISIAGRHDISAIPRITPVIAAMVKLTLADFLL 344 ********************************99999999***************************** PP TIGR00033 346 ekra 349 +++a lcl|NCBI__GCF_000195295.1:WP_013707610.1 345 RQKA 348 9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (353 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.66 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory