Align Branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_011156957.1 TX73_RS07115 PLP-dependent aminotransferase family protein
Query= reanno::azobra:AZOBR_RS06555 (404 letters) >NCBI__GCF_000195775.1:WP_011156957.1 Length = 500 Score = 150 bits (379), Expect = 8e-41 Identities = 116/378 (30%), Positives = 186/378 (49%), Gaps = 22/378 (5%) Query: 27 LLERPEIISFAGGIPDPDFFPTAAIARAYEKIFQSNSGAGGALQYTISEGFTPLREWICA 86 L ERP + F +PD FP + R ++ S G L + G+ PLR+ I Sbjct: 131 LTERPTL--FMPDVPDLQAFPIRSWLRLMNEV--SGRLKGDILVNVSNAGYEPLRDAIAQ 186 Query: 87 YLGR-RGIQAGLDEVLVTSGSQQALEFVGKLLIGPGEKILVTRPTYLGALQAFSPYEPQY 145 +L RG+ +V++T+GSQQ+L+ + +LL+ G+ + + P Y+GA A Sbjct: 187 HLRTARGMMVESRQVIITTGSQQSLDLLARLLVDRGDPVWLEEPGYVGARAALMANGCSV 246 Query: 146 LSVPGDAEGPDLAAVEAALEQKPKFFYLVPDFQNPNGTTISLARREALLDLCAKHGVPIV 205 L +P D EG ++ + P+ + P P G T+S RRE LLDL G I+ Sbjct: 247 LPIPTDEEGINIDLGRSKF-PTPRMVLVSPSRHYPLGGTLSAERREELLDLSRTTGAWIL 305 Query: 206 EDAAYTELRYEGEPIPSMVALDAARNGGKITNVLFCGSFSKTMVPALRVGWINGPAEVIN 265 ED E RY G+P ++ ++D R+G V+ G+FSKT++P+ R+G++ P ++ + Sbjct: 306 EDDYDCEFRYRGQPFAALQSVD--RDG----RVVSIGTFSKTLLPSFRLGFVVVPIDLAD 359 Query: 266 RLVLMKQAGDLHTSTINQIVLHDVVSQN-FDSHIRRLRAGYKERRDAMLTALSEFAPAGV 324 + D H + Q+VL + + + + +HIRR+R+ Y ER+ AML L E + Sbjct: 360 DFAKARAVIDRHAPIMEQMVLAEFMHRGLYSAHIRRMRSLYAERQAAMLQLLDE----TL 415 Query: 325 TWTKPE----GGMFVWIELPEGTDGVDLLARAIKDANVAFVPGSAFHADRSGKNTLRLSF 380 ++T PE GGM + EG D + KD + P S + + R + L L F Sbjct: 416 SYTPPEFECAGGMHFVLPFKEGVDDTAVAHELWKD-RIVSRPLSMYFSGRRKCSGLLLGF 474 Query: 381 SNNNPERIREGIRRLCGL 398 + E I + L GL Sbjct: 475 AAFRAEDILAAGKHLAGL 492 Lambda K H 0.320 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 29 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 404 Length of database: 500 Length adjustment: 33 Effective length of query: 371 Effective length of database: 467 Effective search space: 173257 Effective search space used: 173257 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory