Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_011321312.1 AVA_RS23605 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::Q9WYH8 (338 letters) >NCBI__GCF_000204075.1:WP_011321312.1 Length = 352 Score = 300 bits (767), Expect = 5e-86 Identities = 163/342 (47%), Positives = 226/342 (66%), Gaps = 8/342 (2%) Query: 1 MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLD-CV 59 MIVV+K GS E +I ++ S+ L G+ + VIG++G+ + + + + + Sbjct: 1 MIVVMKVGSPEVEINRINDELTSWGLTPEKIIGKHKVVIGLVGETADLDPLQIQEVSPWI 60 Query: 60 ESVVRVLKPYKLVSREF-HPEDTVIDL----GDVKIG-NGYFTIIAGPCSVEGREMLMET 113 E V+RV PYK SR++ H E + + + G V G N ++AGPCSVE EM++ET Sbjct: 61 EQVLRVELPYKRASRQYRHGEASEVVVNTPDGPVVFGENQALVVVAGPCSVENEEMIIET 120 Query: 114 AHFLSELGVKVLRGGAYKPRTSPYSFQGLGEKGLEYLREAADKYGMYVVTEALGEDDLPK 173 A + G K LRGGAYKPRTSPY+FQG GE LE L +A D G+ ++TE + +L Sbjct: 121 AQRVKAAGAKFLRGGAYKPRTSPYAFQGHGESALELLAKARDVSGLGIITEVMDASELDI 180 Query: 174 VAEYADIIQIGARNAQNFRLLSKAGSYNKPVLLKRGFMNTIEEFLLSAEYIANSGNTKII 233 +AE AD+IQ+GARN QNF LL K G+ KPVLLKRG TIE++L++AEY+ +GN +I Sbjct: 181 IAEVADVIQVGARNMQNFSLLKKVGAQPKPVLLKRGMAATIEDWLMAAEYVLAAGNPNVI 240 Query: 234 LCERGIRTFEKA-TRNTLDISAVPIIRKESHLPILVDPSHSGGRRDLVIPLSRAAIAVGA 292 LCERGIRTF++ TRNTLD+S VP++RK +HLPI++DPSH G + V ++ AAIA G Sbjct: 241 LCERGIRTFDRQYTRNTLDLSVVPVLRKLTHLPIMIDPSHGTGWAEYVPSMAMAAIAAGT 300 Query: 293 HGIIVEVHPEPEKALSDGKQSLDFELFKELVQEMKKLADALG 334 +++EVHP P+KALSDG QSL E F L+QE+ + A+G Sbjct: 301 DSLMIEVHPNPKKALSDGPQSLTPEHFDRLMQELAVIGKAVG 342 Lambda K H 0.318 0.138 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 352 Length adjustment: 29 Effective length of query: 309 Effective length of database: 323 Effective search space: 99807 Effective search space used: 99807 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_011321312.1 AVA_RS23605 (3-deoxy-7-phosphoheptulonate synthase)
to HMM TIGR01361 (aroF: 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01361.hmm # target sequence database: /tmp/gapView.5812.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01361 [M=260] Accession: TIGR01361 Description: DAHP_synth_Bsub: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-124 399.9 0.0 2.8e-124 399.6 0.0 1.0 1 lcl|NCBI__GCF_000204075.1:WP_011321312.1 AVA_RS23605 3-deoxy-7-phosphohep Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000204075.1:WP_011321312.1 AVA_RS23605 3-deoxy-7-phosphoheptulonate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 399.6 0.0 2.8e-124 2.8e-124 3 259 .. 73 336 .. 71 337 .. 0.95 Alignments for each domain: == domain 1 score: 399.6 bits; conditional E-value: 2.8e-124 TIGR01361 3 askkvkkeetvvdved.....vkiGege.liviaGPCsveseeqivetakavkeaGakllrGgafkPrt 65 as+++++ e+ + v + v +Ge++ l+v+aGPCsve+ee+i+eta++vk+aGak+lrGga+kPrt lcl|NCBI__GCF_000204075.1:WP_011321312.1 73 ASRQYRHGEASEVVVNtpdgpVVFGENQaLVVVAGPCSVENEEMIIETAQRVKAAGAKFLRGGAYKPRT 141 67777766555444444558899***997899************************************* PP TIGR01361 66 sPysfqGlgeeglkllkrakdetgllvvtevlderdveivaeyvDilqiGarnmqnfelLkevgkskkP 134 sPy+fqG+ge++l+ll++a+d gl ++tev+d+++++i+ae++D++q+Garnmqnf+lLk+vg++ kP lcl|NCBI__GCF_000204075.1:WP_011321312.1 142 SPYAFQGHGESALELLAKARDVSGLGIITEVMDASELDIIAEVADVIQVGARNMQNFSLLKKVGAQPKP 210 ********************************************************************* PP TIGR01361 135 vlLkrglaatieewleaaeYilsegnenvilcerGirtfe.katrftldlsavallkklthlPvivDps 202 vlLkrg+aatie+wl+aaeY+l++gn+nvilcerGirtf+ ++tr+tldls+v++l+klthlP+++Dps lcl|NCBI__GCF_000204075.1:WP_011321312.1 211 VLLKRGMAATIEDWLMAAEYVLAAGNPNVILCERGIRTFDrQYTRNTLDLSVVPVLRKLTHLPIMIDPS 279 ****************************************889************************** PP TIGR01361 203 haaGrrdlvlplakaavavGadgllievhpdPekalsDseqqltpeefkelvkelka 259 h++G ++v+++a+aa+a+G+d+l+ievhp+P+kalsD++q+ltpe+f++l++el++ lcl|NCBI__GCF_000204075.1:WP_011321312.1 280 HGTGWAEYVPSMAMAAIAAGTDSLMIEVHPNPKKALSDGPQSLTPEHFDRLMQELAV 336 *****************************************************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (260 nodes) Target sequences: 1 (352 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.87 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory