Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate WP_104009967.1 AVA_RS20175 3-deoxy-7-phosphoheptulonate synthase
Query= BRENDA::Q9WYH8 (338 letters) >NCBI__GCF_000204075.1:WP_104009967.1 Length = 362 Score = 310 bits (795), Expect = 3e-89 Identities = 165/342 (48%), Positives = 227/342 (66%), Gaps = 8/342 (2%) Query: 1 MIVVLKPGSTEEDIRKVVKLAESYNLKCHISKGQERTVIGIIGDDRYVVADKFESLD-CV 59 MI+V+KP + +I +V + + L I G + VIG++GD + + ++L+ + Sbjct: 1 MIIVMKPFTPSAEIEQVNEEIRRHELTPEICVGHHKVVIGLVGDTSELDPRQIQNLNPFI 60 Query: 60 ESVVRVLKPYKLVSREF----HPEDTV-IDLGDVKIGNGY-FTIIAGPCSVEGREMLMET 113 E V+R+ KP+K S EF H E V G + G + ++AGPCSVE EM++ET Sbjct: 61 EQVIRIKKPFKRASLEFRYGEHSEVVVPTPNGPITFGQNHPVVVVAGPCSVENEEMIVET 120 Query: 114 AHFLSELGVKVLRGGAYKPRTSPYSFQGLGEKGLEYLREAADKYGMYVVTEALGEDDLPK 173 A + E G + LRGGAYKPRTSPY+FQG GE L L +A + G+ ++TE + DDL K Sbjct: 121 AQAVKEYGAQFLRGGAYKPRTSPYAFQGHGESALALLAKAKEATGLGIITEIMDADDLDK 180 Query: 174 VAEYADIIQIGARNAQNFRLLSKAGSYNKPVLLKRGFMNTIEEFLLSAEYIANSGNTKII 233 + E AD++QIGARN QNF LL K G+ KPVLLKRG TIE++L+SAEYI GN +I Sbjct: 181 LIEVADVLQIGARNMQNFSLLKKIGATTKPVLLKRGLSATIEDWLMSAEYILAGGNPNVI 240 Query: 234 LCERGIRTFEKA-TRNTLDISAVPIIRKESHLPILVDPSHSGGRRDLVIPLSRAAIAVGA 292 LCERGIRTF++ TRNTLDISA+P++R +HLPI++DPSH+ G+ + V ++ A+IA GA Sbjct: 241 LCERGIRTFDRQFTRNTLDISAIPVLRTLTHLPIMIDPSHATGKSEFVPTMTMASIAAGA 300 Query: 293 HGIIVEVHPEPEKALSDGKQSLDFELFKELVQEMKKLADALG 334 +++EVHP P KALSDG QSL E FKEL+ E+ L+ G Sbjct: 301 DSLMIEVHPNPAKALSDGPQSLTLEGFKELMHEITALSKFFG 342 Lambda K H 0.318 0.138 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 362 Length adjustment: 29 Effective length of query: 309 Effective length of database: 333 Effective search space: 102897 Effective search space used: 102897 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_104009967.1 AVA_RS20175 (3-deoxy-7-phosphoheptulonate synthase)
to HMM TIGR01361 (aroF: 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01361.hmm # target sequence database: /tmp/gapView.7970.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01361 [M=260] Accession: TIGR01361 Description: DAHP_synth_Bsub: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-122 391.3 0.0 1.3e-121 390.9 0.0 1.1 1 lcl|NCBI__GCF_000204075.1:WP_104009967.1 AVA_RS20175 3-deoxy-7-phosphohep Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000204075.1:WP_104009967.1 AVA_RS20175 3-deoxy-7-phosphoheptulonate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 390.9 0.0 1.3e-121 1.3e-121 18 258 .. 91 335 .. 72 337 .. 0.95 Alignments for each domain: == domain 1 score: 390.9 bits; conditional E-value: 1.3e-121 TIGR01361 18 d..vkiGege.liviaGPCsveseeqivetakavkeaGakllrGgafkPrtsPysfqGlgeeglkllkr 83 + +++G+++ ++v+aGPCsve+ee+iveta+avke Ga++lrGga+kPrtsPy+fqG+ge++l ll++ lcl|NCBI__GCF_000204075.1:WP_104009967.1 91 NgpITFGQNHpVVVVAGPCSVENEEMIVETAQAVKEYGAQFLRGGAYKPRTSPYAFQGHGESALALLAK 159 335899**9978899****************************************************** PP TIGR01361 84 akdetgllvvtevlderdveivaeyvDilqiGarnmqnfelLkevgkskkPvlLkrglaatieewleaa 152 ak++tgl ++te++d++d++ + e++D+lqiGarnmqnf+lLk++g+++kPvlLkrgl+atie+wl++a lcl|NCBI__GCF_000204075.1:WP_104009967.1 160 AKEATGLGIITEIMDADDLDKLIEVADVLQIGARNMQNFSLLKKIGATTKPVLLKRGLSATIEDWLMSA 228 ********************************************************************* PP TIGR01361 153 eYilsegnenvilcerGirtfe.katrftldlsavallkklthlPvivDpshaaGrrdlvlplakaava 220 eYil+ gn+nvilcerGirtf+ + tr+tld+sa+++l++lthlP+++Dpsha+G++++v+++++a++a lcl|NCBI__GCF_000204075.1:WP_104009967.1 229 EYILAGGNPNVILCERGIRTFDrQFTRNTLDISAIPVLRTLTHLPIMIDPSHATGKSEFVPTMTMASIA 297 **********************788******************************************** PP TIGR01361 221 vGadgllievhpdPekalsDseqqltpeefkelvkelk 258 +Gad+l+ievhp+P+kalsD++q+lt e fkel++e++ lcl|NCBI__GCF_000204075.1:WP_104009967.1 298 AGADSLMIEVHPNPAKALSDGPQSLTLEGFKELMHEIT 335 **********************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (260 nodes) Target sequences: 1 (362 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 12.78 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory