Align Shikimate kinase; SK; EC 2.7.1.71 (uncharacterized)
to candidate WP_041456504.1 AVA_RS24650 gluconokinase
Query= curated2:A0KN29 (172 letters) >NCBI__GCF_000204075.1:WP_041456504.1 Length = 160 Score = 46.2 bits (108), Expect = 3e-10 Identities = 51/169 (30%), Positives = 78/169 (46%), Gaps = 23/169 (13%) Query: 7 IFLIGPMGAGKSTIGRHLAEQLHMEFFDSD--HEIER----RSGADIGWVFDVEGEEGFR 60 I ++G G+GK+TIG+ LAE LH EF+D+D H +E R G + D + + Sbjct: 3 IIIMGVSGSGKTTIGQMLAESLHWEFYDADSFHSLENIEKMRRGIPLD---DADRIPWLQ 59 Query: 61 IREEKVIGDLSEQQGIVLATGGGAIKSRETRNKLSARGI-VVYLETTIEKQLARTQRDKR 119 + + L + +VLA A+K+ + L I +VYL+ T E L +T+ KR Sbjct: 60 SLQTAITNWLQNNRNVVLAC--SALKASYRQFLLLDTDIKLVYLQGTFE--LIQTRLQKR 115 Query: 120 RPLLQTEEPPREVLERLAQERNALYEEVADFVIQTDDQSAKVVANQIVK 168 E L + A EE D VI+ D + V Q++K Sbjct: 116 EHHFMNVE--------LLTSQFASLEE-PDDVIRVDISQSPQVIIQVIK 155 Lambda K H 0.317 0.135 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 66 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 172 Length of database: 160 Length adjustment: 18 Effective length of query: 154 Effective length of database: 142 Effective search space: 21868 Effective search space used: 21868 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory