Align aspartate semialdehyde dehydrogenase (EC 1.2.1.11) (characterized)
to candidate WP_011320317.1 AVA_RS18285 aspartate-semialdehyde dehydrogenase
Query= metacyc::AT1G14810-MONOMER (375 letters) >NCBI__GCF_000204075.1:WP_011320317.1 Length = 347 Score = 350 bits (897), Expect = e-101 Identities = 173/335 (51%), Positives = 239/335 (71%), Gaps = 8/335 (2%) Query: 41 LAVVGVTGAVGQEFLSVLSDRDFPYSSIKMLASKRSAGKRVAFDGHEYTVEELTADSFNG 100 +A++G TGAVG E L +L R+FP + +K+LAS+RS G+ + F G VE ++ + Sbjct: 7 VAILGATGAVGTELLELLESRNFPVAELKLLASERSVGRSLPFKGENIIVEAVSDRALEN 66 Query: 101 VDIALFSAGGSISKEFGPLAAEKGTIVVDNSSAFRMVDGVPLVIPEVNPEAMKGIKVGMG 160 VDI L SAGGS SK + +A EKG +V+DNSSAFRM VPL++PEVNP+A K Sbjct: 67 VDIVLASAGGSTSKAWASVAVEKGAVVIDNSSAFRMNPDVPLIVPEVNPQAAADHK---- 122 Query: 161 KGALIANPNCSTIICLMAVTPLHHHAKVKRMVVSTYQAASGAGAAAMEELVQQTREVLEG 220 +IANPNC+TI+ +AV PLH V+R+V +TYQ+ASGAGA AM E+ Q+ +L+G Sbjct: 123 --GIIANPNCTTILMTLAVWPLHQVRPVQRIVAATYQSASGAGAKAMAEVKTQSSAILKG 180 Query: 221 KPPTCNIFGQQYAFNLFSHNAPILDNGYNEEEMKLVKETRKIWNDTEVKVTATCIRVPVM 280 + P + AFNLF HN+P+ D+GY EEE+K+V ETRKI+ E+++TATC+RVPV+ Sbjct: 181 EEPVAEVLPYPLAFNLFPHNSPLTDSGYCEEELKMVNETRKIFGTQEIRITATCVRVPVL 240 Query: 281 RAHAESVNLQFENPLDENTAREILKKAPGVYIIDDRASNTFPTPLDVSNKDDVAVGRIRR 340 RAH+E++NL+F P + AREIL APGV +++D N FP P++ S +D+V VGRIR+ Sbjct: 241 RAHSEAINLEFAEPFSPDEAREILSHAPGVKLLEDWGKNYFPMPIEASGRDEVLVGRIRQ 300 Query: 341 DVSQDGNFGLDIFVCGDQIRKGAALNAVQIAEMLL 375 D+S GL++++CGDQIRKGAALNAVQIAE+L+ Sbjct: 301 DISHP--CGLELWLCGDQIRKGAALNAVQIAELLV 333 Lambda K H 0.318 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 347 Length adjustment: 29 Effective length of query: 346 Effective length of database: 318 Effective search space: 110028 Effective search space used: 110028 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_011320317.1 AVA_RS18285 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.19610.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-128 412.7 0.0 6.9e-128 412.4 0.0 1.0 1 lcl|NCBI__GCF_000204075.1:WP_011320317.1 AVA_RS18285 aspartate-semialdehy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000204075.1:WP_011320317.1 AVA_RS18285 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 412.4 0.0 6.9e-128 6.9e-128 1 338 [. 6 334 .. 6 335 .. 0.99 Alignments for each domain: == domain 1 score: 412.4 bits; conditional E-value: 6.9e-128 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsa 69 +vai+GatGavG ell++Le rnfp+ +l+llasers G+ + fkg+++ ve+++ e++di l sa lcl|NCBI__GCF_000204075.1:WP_011320317.1 6 RVAILGATGAVGTELLELLESRNFPVAELKLLASERSVGRSLPFKGENIIVEAVSDRALENVDIVLASA 74 69******************************************************************* PP TIGR01296 70 GgsvskefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkp 138 Ggs+sk++a+ a+++g++viDn+safr+++dvPL+vpevn + +++k giianPnC+ti ++ ++ p lcl|NCBI__GCF_000204075.1:WP_011320317.1 75 GGSTSKAWASVAVEKGAVVIDNSSAFRMNPDVPLIVPEVNPQAAADHK--GIIANPNCTTILMTLAVWP 141 ********************************************9998..******************* PP TIGR01296 139 lkdeaklkrvvvstYqavsGaGkkgveeLknqtkavlegkekepeidalkakkfakqiafnaiplidkl 207 l++ ++r+v +tYq+ sGaG+k+++e+k q a+l+g+e a+ ++++afn++p+ l lcl|NCBI__GCF_000204075.1:WP_011320317.1 142 LHQVRPVQRIVAATYQSASGAGAKAMAEVKTQSSAILKGEEPV-------AEVLPYPLAFNLFPHNSPL 203 *************************************999866.......7999*************** PP TIGR01296 208 kedGytkeelkllfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLkeapgvvv 276 ++ Gy +eelk+++etrki+g+++++++atcvrvPv+++hse++++ef++++s++e++e+L +apgv++ lcl|NCBI__GCF_000204075.1:WP_011320317.1 204 TDSGYCEEELKMVNETRKIFGTQEIRITATCVRVPVLRAHSEAINLEFAEPFSPDEAREILSHAPGVKL 272 ********************************************************************* PP TIGR01296 277 iddpsenlyptPleavgkdevfvgrirkDlskekglalfvvaDnlrkGaalnavqiaellik 338 ++d +n +p+P+ea+g+dev+vgrir+D+s+ gl+l++ +D++rkGaalnavqiaell++ lcl|NCBI__GCF_000204075.1:WP_011320317.1 273 LEDWGKNYFPMPIEASGRDEVLVGRIRQDISHPCGLELWLCGDQIRKGAALNAVQIAELLVE 334 ***********************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (347 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.77 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory