Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_011319854.1 AVA_RS15760 threonine synthase
Query= BRENDA::O66740 (352 letters) >NCBI__GCF_000204075.1:WP_011319854.1 Length = 363 Score = 438 bits (1127), Expect = e-128 Identities = 216/351 (61%), Positives = 271/351 (77%), Gaps = 4/351 (1%) Query: 4 WQGIIKQYKKYLPVDENTPIVTLYEGNTPLIEADNLARAIGFKGKIYLKYEGLNPTGSFK 63 W G+I+ Y++YLPV E TP+VTL EGNTPLI +A IG + +++KY+GLNPTGSFK Sbjct: 15 WPGLIEAYREYLPVSEQTPVVTLLEGNTPLIPVPAIAERIGRQVSVFVKYDGLNPTGSFK 74 Query: 64 DRGMTLAISKAVEAGKRAVICASTGNTSASAAAYAARAGLRAYVLLPKGAVAIGKLSQAM 123 DRGMT+AISKA EAG +AVICASTGNTSA+AAAYA R G++A+VL+P G VA+GKL+QA+ Sbjct: 75 DRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYARRGGMKAFVLIPDGYVALGKLAQAL 134 Query: 124 IYGAKVLAIQGTFDDALNIVRKIGENFPVEIVNSVNPYRIEGQKTAAFEICDTLGEAPDY 183 +YGA+VLAI+G FD AL IVR++ E +P+ +VNSVNPYR+EGQKT AFE+ D LG APD+ Sbjct: 135 LYGAEVLAIKGNFDRALEIVREMAETYPITLVNSVNPYRLEGQKTGAFEVVDALGNAPDW 194 Query: 184 HFIPVGNAGNITAYWKGFKIYYEEGKITKLPRMMGWQAEGAAPIVKGYPIKNPQTIATAI 243 IPVGNAGNITAYW GF Y++ GK +LP+MMG+QA GAAP+V G P+ +P+TIATAI Sbjct: 195 LCIPVGNAGNITAYWMGFCQYHQAGKCDRLPQMMGFQAAGAAPLVNGQPVSHPETIATAI 254 Query: 244 KIGNPYSWKSALKAAQESGGKIDAVSDSEILYAYKLIASTEGVFCEPASAASVAGLIKLV 303 +IGNP SW A+ A S G +AV+D EIL AY+L+AS+EG+FCEPASAASVAGL+K+ Sbjct: 255 RIGNPASWDKAIAAQSASQGSFNAVTDEEILDAYRLLASSEGIFCEPASAASVAGLLKVK 314 Query: 304 REGFFKGGEVVTCTLTGNGLKDPDTAIKVCEEPIT--VPPDFDEVVKVLGF 352 + G V C LTGNGLKDPDTAIK + D +V K +GF Sbjct: 315 DQ--VPTGATVVCVLTGNGLKDPDTAIKHSHSQFKQGLEADLKDVAKAMGF 363 Lambda K H 0.317 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 472 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 363 Length adjustment: 29 Effective length of query: 323 Effective length of database: 334 Effective search space: 107882 Effective search space used: 107882 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_011319854.1 AVA_RS15760 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.30617.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-107 345.1 0.0 2.6e-107 344.9 0.0 1.0 1 lcl|NCBI__GCF_000204075.1:WP_011319854.1 AVA_RS15760 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000204075.1:WP_011319854.1 AVA_RS15760 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 344.9 0.0 2.6e-107 2.6e-107 1 340 [] 19 336 .. 19 336 .. 0.98 Alignments for each domain: == domain 1 score: 344.9 bits; conditional E-value: 2.6e-107 TIGR00260 1 vvryreilevt.ekdlvdlaegstelfrspklaeevga.enlyvkelfhgPtlaFKDrglqfvavlltk 67 ++ yre+l+v+ ++++v+l eg+t+l+ +p++ae++g ++vk ++++Pt++FKDrg ++++++k lcl|NCBI__GCF_000204075.1:WP_011319854.1 19 IEAYREYLPVSeQTPVVTLLEGNTPLIPVPAIAERIGRqVSVFVKYDGLNPTGSFKDRG---MTMAISK 84 678***********************************99*******************...******* PP TIGR00260 68 alelgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDda 136 a+e+g+++v+cA++G+t+aaaa a+a++ ++k++vL+P+g+++ +kl++al ++a+vlaikG+FD a lcl|NCBI__GCF_000204075.1:WP_011319854.1 85 AKEAGAKAVICASTGNTSAAAA-AYARRGGMKAFVLIPDGYVA--LGKLAQALLYGAEVLAIKGNFDRA 150 **********************.********************..************************ PP TIGR00260 137 qdlvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvp.sgnfgailkGflek 204 +++v+e++e +++++nsvN p+r+e+qkt afe+v++lg ++pd++++pv+ +gn++a+++Gf+++ lcl|NCBI__GCF_000204075.1:WP_011319854.1 151 LEIVREMAETYPITLVNSVN---PYRLEGQKTGAFEVVDALG-NAPDWLCIPVGnAGNITAYWMGFCQY 215 ********999999999999...*******************.************************** PP TIGR00260 205 kelg....lpieklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnveralelarrslgnl 269 +++g lp ++++++a gaa+ v+ + p +++eT++tA++ignp+++++a ++ s+g + lcl|NCBI__GCF_000204075.1:WP_011319854.1 216 HQAGkcdrLP-QMMGFQAAGAAPLVNGQ-------PVSHPETIATAIRIGNPASWDKAIAAQSASQGSF 276 **********.************99988.......9********************************* PP TIGR00260 270 edlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaKFeevvealtgnklkd 338 +++ +deeil+a+++la +eg+++ep++a++va+l+k + +++ + ++vv++ltgn+lkd lcl|NCBI__GCF_000204075.1:WP_011319854.1 277 NAV----TDEEILDAYRLLASSEGIFCEPASAASVAGLLKVKD-----QVPTG--ATVVCVLTGNGLKD 334 ***....*********************************987.....7899*..************** PP TIGR00260 339 pe 340 p+ lcl|NCBI__GCF_000204075.1:WP_011319854.1 335 PD 336 97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (363 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.50 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory