Align Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 (uncharacterized)
to candidate WP_013722484.1 ALIDE2_RS14965 phosphogluconate dehydratase
Query= curated2:A8AB39 (552 letters) >NCBI__GCF_000204645.1:WP_013722484.1 Length = 605 Score = 266 bits (680), Expect = 2e-75 Identities = 191/544 (35%), Positives = 283/544 (52%), Gaps = 35/544 (6%) Query: 30 RRPLIGVANSWNEIVPGHVHLDKVAEAVKAGIRMAGGTPLEFGTI-AVCDGIAMGHEGMR 88 + P IG+ S+N+++ H L +K R G T G + A+CDG+ G GM Sbjct: 66 KAPNIGIVTSYNDMLSAHAPLASYPGLIKDEARRCGATAQVAGGVPAMCDGVTQGTPGME 125 Query: 89 YSLPSREVIADTVEIMVEAHRLDAVVMVTNCDKITPGFLLAAARLE-VPVILINGGPMMP 147 SL SR+VIA + + DA +M+ CDKI PG L+ A + +P + + GPM Sbjct: 126 LSLFSRDVIAMATAVALSHDVFDAALMLGVCDKIVPGLLVGALQFGYLPTVFVPAGPMTS 185 Query: 148 GVYGKERIDFKDLMERMNVLIKEGRTEELRKLEESALPGPGSCAGLFTANTMNMLSEAMG 207 G+ + ++ + L+ G EL + E +A PG+C TAN+ ML EAMG Sbjct: 186 GLSNSAKAKVRE--QAAQGLVGRG---ELLQAEMAAYHSPGTCTFYGTANSNQMLLEAMG 240 Query: 208 LMLPGASTVPAVEARRLWYAKLTGMRIVKMVEEGLTP-DKILTRKALENAIAVDMALGGS 266 L +PG + V A R + ++ P +++ +A+ NA+ +A GGS Sbjct: 241 LHVPGTAFVNPGHALREELTREAARTVLGSAGAPCPPIGRVVDERAIVNAMVALLATGGS 300 Query: 267 TNSVLHLEALAYELGIDLPLEVFDEISRKVPHIASISPSGRHFVVDLDRAGGIPAVLKEL 326 TN ++H A+A GI + + F +S VP +A + P+G V AGG V++EL Sbjct: 301 TNHLIHWVAVARAAGIVIDWDDFSALSAAVPLLARVYPNGSADVNRFQAAGGPGYVIREL 360 Query: 327 GEAGLIHKDALTVTGKTVWENVK----DA----------AVLDREVIRPLDNPYSPFGGL 372 +AGL+H+D LTV + E + DA A D V+RP +P+S GGL Sbjct: 361 LDAGLMHEDVLTVRPGGIREYTRVPEGDAGQRLRWADVGASRDDSVLRPAADPFSATGGL 420 Query: 373 AILKGSLAPNGAVVKASAVKRELWKFKGVARVFDREEDAVKAIRGGEIEPGTVIVIRYEG 432 +L G+L +V+K SAV R+ + ARVF + + ++A + GE+E V V+R++G Sbjct: 421 KLLSGNL--GRSVIKVSAVPRDHHVVEAPARVFASQGELLQAFQAGELERDVVCVVRWQG 478 Query: 433 PRGGPGMREM--LTATAAVMALGLGDKVALVTDGRFSGAT-RGPAIGHVSPEAAAGGPIA 489 PR GM E+ LT AV+ G G KVALVTDGR SGA+ + PA H SPEA AGGP+A Sbjct: 479 PRAN-GMPELHKLTPPLAVLQ-GKGHKVALVTDGRMSGASGKVPAAIHASPEAHAGGPLA 536 Query: 490 LVQDGDEIVIDIEKRRLDLLVDEKELEERRARWKP------KVKPLRRGILRRYAKMALS 543 V+DGD I +D LD+L+D E + R+ P R + + + ALS Sbjct: 537 RVRDGDPIRLDAVAGTLDVLIDAAEWQARQPAAMPPGLHEDNAHGWGRELFAGFRRNALS 596 Query: 544 ADKG 547 A++G Sbjct: 597 AEEG 600 Lambda K H 0.319 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 898 Number of extensions: 55 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 552 Length of database: 605 Length adjustment: 36 Effective length of query: 516 Effective length of database: 569 Effective search space: 293604 Effective search space used: 293604 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory