Align threonine synthase (EC 4.2.3.1) (characterized)
to candidate WP_013819451.1 METME_RS14265 threonine synthase
Query= BRENDA::O66740 (352 letters) >NCBI__GCF_000214665.1:WP_013819451.1 Length = 364 Score = 401 bits (1031), Expect = e-116 Identities = 195/355 (54%), Positives = 265/355 (74%), Gaps = 7/355 (1%) Query: 3 RWQGIIKQYKKYLPVDENTPIVTLYEGNTPLIEADNLARAIGFKGKIYLKYEGLNPTGSF 62 R+ G+I++Y+ LPV +T +++L EGNTPLI +N+ R IG IY+K+EGLNPTGSF Sbjct: 6 RYTGLIERYRDRLPVSADTRLISLCEGNTPLIRLENIPRLIGKDVDIYVKFEGLNPTGSF 65 Query: 63 KDRGMTLAISKAVEAGKRAVICASTGNTSASAAAYAARAGLRAYVLLPKGAVAIGKLSQA 122 KDRGMT+A++KAVE G +A+ICASTGNTSASAAAYA RAG++A+VL+P+G +A+GKL+Q Sbjct: 66 KDRGMTMAVTKAVEEGSQAIICASTGNTSASAAAYAVRAGIKAFVLIPEGKIALGKLAQT 125 Query: 123 MIYGAKVLAIQGTFDDALNIVRKIGENFPVEIVNSVNPYRIEGQKTAAFEICDTLGEAPD 182 ++YGA+++ I G FD +NIV++I ++ PV IVNS+NP+R++GQKTAAFEI D LG APD Sbjct: 126 LMYGAQIIQINGNFDAGMNIVKQIADHAPVAIVNSINPFRLQGQKTAAFEIIDELGGAPD 185 Query: 183 YHFIPVGNAGNITAYWKGFKIYYEE-----GKITKLPRMMGWQAEGAAPIVKGYPIKNPQ 237 YH +PVGNAGNI+AYW G+ Y ++ K P M G+QA GAAP V G I +P+ Sbjct: 186 YHCLPVGNAGNISAYWMGYTEYAQDLPGLPAVADKRPIMCGYQAAGAAPFVAGKMIDHPE 245 Query: 238 TIATAIKIGNPYSWKSALKAAQESGGKIDAVSDSEILYAYKLIASTEGVFCEPASAASVA 297 T+ATAI+IG+P SW A A +ESGG D+ +D +IL A K+++ EGVFCEPASAAS+A Sbjct: 246 TVATAIRIGHPQSWDLAWNAQKESGGWFDSQTDQQILAAQKMLSQYEGVFCEPASAASLA 305 Query: 298 GLIKLVREGFFKGGEVVTCTLTGNGLKDPDTAIKVCEE--PITVPPDFDEVVKVL 350 G ++ + G G + CTLTGNG+KDPD AI C++ P+T+ + D V K + Sbjct: 306 GALQDIGSGKIPEGSRIVCTLTGNGIKDPDIAISQCKDAHPVTIEANLDAVKKAI 360 Lambda K H 0.317 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 431 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 364 Length adjustment: 29 Effective length of query: 323 Effective length of database: 335 Effective search space: 108205 Effective search space used: 108205 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_013819451.1 METME_RS14265 (threonine synthase)
to HMM TIGR00260 (thrC: threonine synthase (EC 4.2.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00260.hmm # target sequence database: /tmp/gapView.29275.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00260 [M=340] Accession: TIGR00260 Description: thrC: threonine synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-94 300.3 0.0 1e-93 300.1 0.0 1.0 1 lcl|NCBI__GCF_000214665.1:WP_013819451.1 METME_RS14265 threonine synthase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000214665.1:WP_013819451.1 METME_RS14265 threonine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 300.1 0.0 1e-93 1e-93 1 340 [] 11 335 .. 11 335 .. 0.95 Alignments for each domain: == domain 1 score: 300.1 bits; conditional E-value: 1e-93 TIGR00260 1 vvryreilevt.ekdlvdlaegstelfrspklaeevga.enlyvkelfhgPtlaFKDrglqfvavlltk 67 ++ryr l+v+ +++l++l+eg+t+l+r +++++ +g+ ++yvk ++++Pt++FKDrg +++++tk lcl|NCBI__GCF_000214665.1:WP_013819451.1 11 IERYRDRLPVSaDTRLISLCEGNTPLIRLENIPRLIGKdVDIYVKFEGLNPTGSFKDRG---MTMAVTK 76 78************************************9********************...******* PP TIGR00260 68 alelgnetvlcAtsGdtgaaaaealagkanvkvvvLyPkgkispvkeklvtalaenakvlaikGdFDda 136 a e+g ++++cA++G+t+a+aa a+a +a++k++vL+P+gki+ +kl+++l+++a++++i+G+FD+ lcl|NCBI__GCF_000214665.1:WP_013819451.1 77 AVEEGSQAIICASTGNTSASAA-AYAVRAGIKAFVLIPEGKIA--LGKLAQTLMYGAQIIQINGNFDAG 142 **********************.********************..************************ PP TIGR00260 137 qdlvkeifedkeklklnsvNsinparieaqktyafeiveqlgkespdkvvvpvp.sgnfgailkGflek 204 ++vk+i+++ + + +ns+N p+r+++qkt+afei+++lg +pd ++pv+ +gn++a+++G+ e+ lcl|NCBI__GCF_000214665.1:WP_013819451.1 143 MNIVKQIADHAPVAIVNSIN---PFRLQGQKTAAFEIIDELG-GAPDYHCLPVGnAGNISAYWMGYTEY 207 ********988877766666...*******************.89**********************99 PP TIGR00260 205 kelg.........lpieklaiaaegaadivrrflksgdlepkedkeTlstAmdignpsnveralelarr 264 + +p + + +a gaa++v + ++eT++tA++ig+p +++ a+++ ++ lcl|NCBI__GCF_000214665.1:WP_013819451.1 208 AQDLpglpavadkRP-IMCGYQAAGAAPFVAGK-------MIDHPETVATAIRIGHPQSWDLAWNAQKE 268 987445777777777.67788888887777655.......68889************************ PP TIGR00260 265 slgnledlkesvsdeeileaikklaeeegyllephtavavaalkklvekgvsatadpaKFeevvealtg 333 s+g +++ +d++il a+k l + eg+++ep++a+++a+ ++ + +g +++++ +++v+ ltg lcl|NCBI__GCF_000214665.1:WP_013819451.1 269 SGGWFDSQ----TDQQILAAQKMLSQYEGVFCEPASAASLAGALQDIGSG---KIPEG--SRIVCTLTG 328 ********....************************************99...*****..********* PP TIGR00260 334 nklkdpe 340 n+ kdp+ lcl|NCBI__GCF_000214665.1:WP_013819451.1 329 NGIKDPD 335 *****97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (340 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.91 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory