Align 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 (characterized)
to candidate WP_013834642.1 THICY_RS00400 3-dehydroquinate synthase
Query= SwissProt::Q8RU74 (442 letters) >NCBI__GCF_000214825.1:WP_013834642.1 Length = 359 Score = 418 bits (1074), Expect = e-121 Identities = 210/354 (59%), Positives = 267/354 (75%), Gaps = 5/354 (1%) Query: 83 VDLGTRSYPIYIGAGLLDQPDLLQRHIHGKRVLVVTNTTVAPLYLDKTISALTDGNPNVT 142 VDL RSYPI+IG LL QP L+ + G +V++VTN+TVAPLYLD+ + TD + Sbjct: 6 VDLAERSYPIFIGQDLLQQPGLVAPFVKGTQVMIVTNSTVAPLYLDRAKALFTD----LQ 61 Query: 143 VESVILPDGEQFKNMETLMKVFDKAIESRLDRRCTFVALGGGVIGDMCGYAAASYLRGVN 202 V++V+LPDGE++KN+E L ++FD+ I DR+ T VALGGGVIGDM G+AAA+Y RGV Sbjct: 62 VDAVVLPDGEEYKNLEILNRIFDQLIGGHFDRKSTLVALGGGVIGDMTGFAAAAYQRGVP 121 Query: 203 FIQIPTTVMAQVDSSVGGKTGINHPLGKNMIGAFYQPQCVLIDTDTLNTLPDRELASGLA 262 FIQIPTT+++QVDSSVGGKTG+NHP GKNMIGAF+QPQ V+IDT TLNTL DR+L++GLA Sbjct: 122 FIQIPTTLLSQVDSSVGGKTGVNHPQGKNMIGAFHQPQAVVIDTLTLNTLEDRQLSAGLA 181 Query: 263 EVIKYGLIRDAEFFEWQEQNMPLLLARDPTAFTYAIKRSCENKADVVSQDEKESGVRATL 322 EVIKYGLIRD FFEW EQN+ L+ARD AI+RSC+NKAD+V+ DE E G RA L Sbjct: 182 EVIKYGLIRDLAFFEWLEQNLEGLMARDHALLAQAIERSCQNKADIVAADETEQGQRALL 241 Query: 323 NLGHTFGHAVETGVGYGQWLHGEAVAAGTVMAVDMSRRLGWIDDSLVQRVQKILQQAKLP 382 NLGHTFGHA+E G+GYG WLHGEA++AG + A MS+ LG + + V+R+ I ++AKLP Sbjct: 242 NLGHTFGHAIEAGMGYGAWLHGEAISAGMMQAAYMSQLLGDLSAADVERIGAIFKRAKLP 301 Query: 383 TSPPETMTVEMFKSIMAVDKKVADGKLRLILLKGSLGNCVFTGDYDQKALDETL 436 PP ++ E F MA DKKV GK+RL+LLK S+G +GDY + L +TL Sbjct: 302 IYPPNELSNEQFMHYMAGDKKVQAGKVRLVLLK-SIGQAYISGDYPAELLQKTL 354 Lambda K H 0.318 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 359 Length adjustment: 31 Effective length of query: 411 Effective length of database: 328 Effective search space: 134808 Effective search space used: 134808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_013834642.1 THICY_RS00400 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.31708.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-121 389.1 0.0 1.1e-120 388.9 0.0 1.0 1 lcl|NCBI__GCF_000214825.1:WP_013834642.1 THICY_RS00400 3-dehydroquinate s Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000214825.1:WP_013834642.1 THICY_RS00400 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 388.9 0.0 1.1e-120 1.1e-120 1 340 [. 13 351 .. 13 355 .. 0.95 Alignments for each domain: == domain 1 score: 388.9 bits; conditional E-value: 1.1e-120 TIGR01357 1 ykvkvgegllkklveelae.kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletv 68 y++ +g++ll++ k ++++++t+++v+ l+ ++ +++ + +v+ +v+pdgee+K+le + lcl|NCBI__GCF_000214825.1:WP_013834642.1 13 YPIFIGQDLLQQPGLVAPFvKGTQVMIVTNSTVAPLYLDRAKALFTD--LQVDAVVLPDGEEYKNLEIL 79 578899999996544433345699***************99999976..9******************* PP TIGR01357 69 aklldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplg 137 +++ dql+ +++rks+lva+GGGv+gD++GF+Aa+y+RG++++q+PTtll++vDssvGGKtg+n+p+g lcl|NCBI__GCF_000214825.1:WP_013834642.1 80 NRIFDQLIGGHFDRKSTLVALGGGVIGDMTGFAAAAYQRGVPFIQIPTTLLSQVDSSVGGKTGVNHPQG 148 ********************************************************************* PP TIGR01357 138 kNliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeel 206 kN+iGaf+qP+aV+id+ +l+tl +r+l++G+aEviK+gli d ++fe+le+n + l + +++ l+++ lcl|NCBI__GCF_000214825.1:WP_013834642.1 149 KNMIGAFHQPQAVVIDTLTLNTLEDRQLSAGLAEVIKYGLIRDLAFFEWLEQNLEGLMAR-DHALLAQA 216 *****************************************************9987765.559***** PP TIGR01357 207 ikrsievKaevVeeDekesglRalLNfGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklgllka 274 i+rs++ Ka++V++De+e+g RalLN+GHt+gHaiEa ++y+ + HGea++ Gm+++a++s+ lg l+a lcl|NCBI__GCF_000214825.1:WP_013834642.1 217 IERSCQNKADIVAADETEQGQRALLNLGHTFGHAIEAGMGYGaWLHGEAISAGMMQAAYMSQLLGDLSA 285 ********************************************************************* PP TIGR01357 275 ellerlvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaalasevteeell 340 ++er+ a++k+++lp+ +++ls e++++++ DKK +++k++lvll++iG+a+++ ++++e l+ lcl|NCBI__GCF_000214825.1:WP_013834642.1 286 ADVERIGAIFKRAKLPIYPPNELSNEQFMHYMAGDKKVQAGKVRLVLLKSIGQAYISGDYPAELLQ 351 *******************************************************99888776655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.47 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory