Align chorismate synthase (EC 4.2.3.5) (characterized)
to candidate WP_013843078.1 DESRU_RS15750 chorismate synthase
Query= BRENDA::Q71Y87 (388 letters) >NCBI__GCF_000215085.1:WP_013843078.1 Length = 387 Score = 441 bits (1135), Expect = e-128 Identities = 218/387 (56%), Positives = 283/387 (73%), Gaps = 2/387 (0%) Query: 1 MRYLTAGESHGPGLTTIIEGLPAGMPLLAEDVNKELKRRQGGHGRGARMRIEKDQVQITA 60 +R+LTAGESHGP LT I+EG+ AG+PL E VN++L RRQGG+GRG RM+IE+DQ + Sbjct: 2 LRFLTAGESHGPVLTAIVEGMVAGLPLSREYVNRQLARRQGGYGRGGRMKIEQDQADFLS 61 Query: 61 GIRHGKTLGAPVAMFVENKDWKHWETVMSIEPVPEKNEKSRRVSRPRPGHADLVGGMKYG 120 G+R G T G+P+ + V NKDW +W +M+ P PE + R V+RPRPGHADL G +KY Sbjct: 62 GVRGGLTTGSPITLQVVNKDWANWSEIMA--PGPEARLEERVVTRPRPGHADLAGAIKYN 119 Query: 121 HNDMRNVLERSSARETTVRVAAGAVAKKLLHELGIEVAGHVLEIGGTRANLTRDYAVSEI 180 D+RN+LERSSARET VRVA G +A+ LL ELGI++ G V IG A L + ++ Sbjct: 120 QQDIRNILERSSARETAVRVAVGTIARALLAELGIQMTGWVRRIGSVEAVLEEEQTADQL 179 Query: 181 QETSEASPVRCLDGVAAEEMMQKIDDAKKNGDTIGGIVEVVVGGVPAGLGSYVQWDKKLD 240 +E + AS + C DG A M+++ID A+ NGD++GG+ E+ V VPAGLGS+VQWD+KLD Sbjct: 180 RELAGASQLLCPDGQAEAAMIREIDRARGNGDSLGGVFEIRVDHVPAGLGSHVQWDRKLD 239 Query: 241 AKIARAIVSINAFKGAEFGVGFEAARKPGSEVMDEILWSKEDGYTRRTNNLGGFEGGMTN 300 +++A A++SI A KG E G+GF AA PGS+V DEI +S E Y R TN GG EGG++N Sbjct: 240 SRLAGALMSIQAIKGVEIGLGFGAAAVPGSQVHDEIFYSPEKSYYRATNRAGGIEGGISN 299 Query: 301 GMPIVVRGVMKPIPTLYKPLQSVDIDSKETFNASVERSDSCAVPAASVVAEAVVAWEVAV 360 G P+VVR MKPIPTLYKPL+SVD SKE F ASVERSD+CAVPAA VV EAVVAWE+AV Sbjct: 300 GEPLVVRAAMKPIPTLYKPLRSVDTGSKEPFTASVERSDACAVPAACVVGEAVVAWEIAV 359 Query: 361 AVLEKFDGDRFDTLKKHVEEHRNLTKE 387 A+LEKF GD L++ V++ R+ ++ Sbjct: 360 AILEKFGGDSLRELRERVDQWRSWIRQ 386 Lambda K H 0.315 0.133 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 438 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 387 Length adjustment: 30 Effective length of query: 358 Effective length of database: 357 Effective search space: 127806 Effective search space used: 127806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
Align candidate WP_013843078.1 DESRU_RS15750 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.24624.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-126 405.6 0.0 9.5e-126 405.4 0.0 1.0 1 lcl|NCBI__GCF_000215085.1:WP_013843078.1 DESRU_RS15750 chorismate synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000215085.1:WP_013843078.1 DESRU_RS15750 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 405.4 0.0 9.5e-126 9.5e-126 1 350 [. 2 367 .. 2 368 .. 0.94 Alignments for each domain: == domain 1 score: 405.4 bits; conditional E-value: 9.5e-126 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 lr++t+GeSHg+ l+ai++G+ agl+l+ e+++++l+rR+ g++r+ rm+ E+D+ ++lsGv+ G TtG lcl|NCBI__GCF_000215085.1:WP_013843078.1 2 LRFLTAGESHGPVLTAIVEGMVAGLPLSREYVNRQLARRQGGYGRGGRMKIEQDQADFLSGVRGGLTTG 70 699****************************************************************** PP TIGR00033 70 aPiallikNkd...........vrskdyed....ikelpRPgHadytylkKYgikd.regggrsSaReT 122 +Pi+l++ Nkd ++ + ++pRPgHad+++ KY+ +d r++++rsSaReT lcl|NCBI__GCF_000215085.1:WP_013843078.1 71 SPITLQVVNKDwanwseimapgPEA----RleerVVTRPRPGHADLAGAIKYNQQDiRNILERSSARET 135 ***********98888874333333....2444599********************************* PP TIGR00033 123 aarvaaGavakklLketagieivayvvklgeveleeesak..eiskerldkspvrcpdaeaekemeeei 189 a+rva+G++a++lL+e gi+++++v+++g+ve+ e+ + + +e + +s++ cpd +ae++m ei lcl|NCBI__GCF_000215085.1:WP_013843078.1 136 AVRVAVGTIARALLAE-LGIQMTGWVRRIGSVEAVLEEEQtaDQLRELAGASQLLCPDGQAEAAMIREI 203 ****************.88************98654443334778999999****************** PP TIGR00033 190 dkakkdgdsvGgvvevvvsnvpvglG..eplfdkldaelasallsinAvKgveiGdGFeaasvrGsean 256 d+a+ +gds+Ggv e+ v vp+glG +++++kld++la al+si+A+KgveiG GF aa v+Gs+++ lcl|NCBI__GCF_000215085.1:WP_013843078.1 204 DRARGNGDSLGGVFEIRVDHVPAGLGshVQWDRKLDSRLAGALMSIQAIKGVEIGLGFGAAAVPGSQVH 272 **************************9999*************************************** PP TIGR00033 257 Delvle.ddkirrktnnsGGieGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcv 324 De+ ++ ++ + r tn+ GGieGGi+nGe+++vr+a+Kpipt++kpl++vd+ ke+ +a+++R+D c+ lcl|NCBI__GCF_000215085.1:WP_013843078.1 273 DEIFYSpEKSYYRATNRAGGIEGGISNGEPLVVRAAMKPIPTLYKPLRSVDTGSKEPFTASVERSDACA 341 ***9998999*********************************************************** PP TIGR00033 325 vpravpvvEamvalvladallekras 350 vp+a +v Ea+va +a a+lek++ lcl|NCBI__GCF_000215085.1:WP_013843078.1 342 VPAACVVGEAVVAWEIAVAILEKFGG 367 **********************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (387 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.11 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory