Align ATP-dependent reduction of co(II)balamin (RamA-like) (EC:2.1.1.13) (characterized)
to candidate WP_013841581.1 DESRU_RS07880 DUF4445 domain-containing protein
Query= reanno::Phaeo:GFF1501 (698 letters) >NCBI__GCF_000215085.1:WP_013841581.1 Length = 541 Score = 208 bits (529), Expect = 6e-58 Identities = 142/438 (32%), Positives = 223/438 (50%), Gaps = 37/438 (8%) Query: 232 GLAVDLGSTTIAAHLCDLKTGDVVASSGIMNPQIRFGEDLMSRVSYSMMNKGGDQEMTRA 291 G+AVDLG+TTI +L DL +G + ++N Q +G D++SR+++++ +E+ A Sbjct: 124 GMAVDLGTTTIVGYLYDLYSGRRLGVMPVVNGQRIYGADVISRLAHAIKGPDAYRELRGA 183 Query: 292 VREGMNALFTQIAAEAEIDKALIVDAVFVCNPVMHHLFLGIDPFELGQAPFALATSNALA 351 V + +N LF + + + + V V NP M HL L + L PF Sbjct: 184 VLQDLNQLFLGCCEQGGVSPRFLREIVLVGNPAMMHLVLNLPVESLAAVPFCPYEPGPFY 243 Query: 352 LRAVELDLNIHPAARVYLLPCIAGHVGADAAAVALSEAPDKSEDLVLVVDVGTNAEILLG 411 A EL L A Y P I G VG+DA A A + ++ +L+VD+GTN EILL Sbjct: 244 RTAEELGLESVSRAICYFPPFIGGFVGSDALAAAQVHGFGERQETLLLVDIGTNGEILLQ 303 Query: 412 NKDKVLACSSPTGPAFEGAQISSGQRAAPGAIERVEINPETKEPRFRVIGSDIWSDEDGF 471 +++LA S+P GPA EG I+ G+ A GAI +V + D D Sbjct: 304 FGEQLLAASAPAGPALEGGNIACGKTAVTGAIHKVTM------------------DYDVH 345 Query: 472 AAAVATTGITGICGSGIIEAIAEMRMAG-------LLDASGLIGSAEQTGTTRCI--QDG 522 + + TGICGSG+++A+AEM G L+ ASGL R + DG Sbjct: 346 LEVIGSAKPTGICGSGLVDAVAEMLRLGIIKSDGELVKASGLPPITSYKIKQRLVTGADG 405 Query: 523 RTNAYLLWDGSVEGGPTITVTNPDIRAIQMAKAALYSGARLLMDKFGI--DTVDRVVLAG 580 N +L D + + DIR IQ+AK A+ +G ++LMD+ GI ++ ++LAG Sbjct: 406 -LNQLMLTD-------KLYLHQKDIREIQLAKGAVAAGIQVLMDEAGIGEKELNSLLLAG 457 Query: 581 AFGAHISAKHAMVLGMIPDCPLDKVTSAGNAAGTGARIALLNTEARSEIEATVQQIEKIE 640 FG +++ +A+ +G++ PL K+ GNAAG+GA + LL+ R E + + +E Sbjct: 458 GFGNYLNPANALRMGLLGLAPLHKIRQVGNAAGSGACMILLSYPERQRAEKLSLRFKHLE 517 Query: 641 TAVEPRFQEHFVNASAIP 658 A + R+++ F++ P Sbjct: 518 LAEDCRYRQQFISQLNFP 535 Score = 48.9 bits (115), Expect = 6e-10 Identities = 29/69 (42%), Positives = 33/69 (47%) Query: 18 ASHPLVVFTPSGKRGRFPVGTPVLTAARQLGVDLDSVCGGRGICSKCQITPSYGEFSKHG 77 AS V F P P GT +L AARQ GV L + CGG G C C+I + GE Sbjct: 3 ASKVRVTFKPHNVEIAVPAGTTILEAARQAGVPLTAPCGGNGRCGGCRIQTASGEEFLAC 62 Query: 78 VTVADDALT 86 T D LT Sbjct: 63 RTKIDQPLT 71 Lambda K H 0.318 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 819 Number of extensions: 40 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 698 Length of database: 541 Length adjustment: 37 Effective length of query: 661 Effective length of database: 504 Effective search space: 333144 Effective search space used: 333144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
Align candidate WP_013841581.1 DESRU_RS07880 (DUF4445 domain-containing protein)
to HMM PF14574 (RACo_C_ter)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF14574.10.hmm # target sequence database: /tmp/gapView.23240.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: RACo_C_ter [M=261] Accession: PF14574.10 Description: C-terminal domain of RACo the ASKHA domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.5e-77 243.6 0.0 1.6e-76 242.9 0.0 1.3 1 lcl|NCBI__GCF_000215085.1:WP_013841581.1 DESRU_RS07880 DUF4445 domain-con Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000215085.1:WP_013841581.1 DESRU_RS07880 DUF4445 domain-containing protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 242.9 0.0 1.6e-76 1.6e-76 1 253 [. 287 538 .. 287 540 .. 0.94 Alignments for each domain: == domain 1 score: 242.9 bits; conditional E-value: 1.6e-76 RACo_C_ter 1 eislliDiGTNaEivlgnkdwllaasaaaGPAlEGgeikcGmrAapgAierveidpetlevelkvigne 69 e+ ll+DiGTN+Ei l+ ++llaasa+aGPAlEGg+i cG +A +gAi++v++d + v+l+vig++ lcl|NCBI__GCF_000215085.1:WP_013841581.1 287 ETLLLVDIGTNGEILLQFGEQLLAASAPAGPALEGGNIACGKTAVTGAIHKVTMDYD---VHLEVIGSA 352 6789************************************************99877...5******** PP RACo_C_ter 70 kpkGicGsGiidliaelleagiidkkgklnkelkserireeeeteeyvlvlaeeset..ekdivitekD 136 kp+GicGsG++d++ae+l+ gii+++g+l k + i++ + ++++v + ++ ++++++++kD lcl|NCBI__GCF_000215085.1:WP_013841581.1 353 KPTGICGSGLVDAVAEMLRLGIIKSDGELVKASGLPPITSYKIKQRLVTGADGLNQLmlTDKLYLHQKD 421 *******************************999999998876666666555434333367******** PP RACo_C_ter 137 idelirakaAiyagvktLleevglevedidkvylaGafGsyidlekAitiGllPdlelekvkqvGNtsl 205 i+e++ ak+A+ ag+++L++e+g+ +++++++laG+fG+y+++++A+++Gll +l+k++qvGN+++ lcl|NCBI__GCF_000215085.1:WP_013841581.1 422 IREIQLAKGAVAAGIQVLMDEAGIGEKELNSLLLAGGFGNYLNPANALRMGLLGLAPLHKIRQVGNAAG 490 ********************************************************************* PP RACo_C_ter 206 agAraallsreareeleeiarkityielavekkFmeefvaalflphtd 253 +gA ++lls +r+++e+++ + +++ela++ ++ ++f+++l +p+++ lcl|NCBI__GCF_000215085.1:WP_013841581.1 491 SGACMILLSYPERQRAEKLSLRFKHLELAEDCRYRQQFISQLNFPEKE 538 *********************************************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (541 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 18.67 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory