Align fused D-3-phosphoglycerate dehydrogenase / phosphoserine phosphatase (EC 1.1.1.95; EC 3.1.3.3) (characterized)
to candidate WP_013840110.1 DESRU_RS00110 phosphoglycerate dehydrogenase
Query= reanno::Cola:Echvi_2777 (630 letters) >NCBI__GCF_000215085.1:WP_013840110.1 Length = 526 Score = 202 bits (514), Expect = 3e-56 Identities = 131/368 (35%), Positives = 202/368 (54%), Gaps = 19/368 (5%) Query: 233 INVLLLENVHPIGVEIMKQEGYNVEVVSSAMSEEELCEKIKNVSIIGIRSKTQITKKVLE 292 + VL+++ V G+ ++Q+ V+ + M+E+EL I + +RS T++T +V+E Sbjct: 1 MKVLVMDGVAEKGLAPLRQQPDIEVVIGNKMTEDELVAVIGQYDGLIVRSATKVTARVIE 60 Query: 293 NANRLMAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIFLMRNLHDKT 352 A RL +G +G + ID KGI V NAP NT + EL ++ ++ L R + Sbjct: 61 AATRLKVIGRAGVGVDNIDRNAATNKGILVVNAPDGNTIAAAELTMAMMLSLARKVPMAC 120 Query: 353 LKMHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYD--IVERLALG 410 K+ G W+K A E+RGK LG+IG G IG+ ++ A+ M M++ YD I E A Sbjct: 121 SKLKSGCWDKKAFMGMELRGKTLGVIGLGRIGSAVAKRAQAMEMHIVAYDPYISEEHAQK 180 Query: 411 NATKIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGHVVDVPAL 470 A ++ SLD++ E DII++H+ E +++NKE + KMK+G ++N +RG +VD PAL Sbjct: 181 MAVELLSLDKVFEQADIITIHMPKTKETYHMINKEALEKMKEGVRIINCARGGIVDEPAL 240 Query: 471 RDALESGHLAGAAVDVFPTEPKNNDEPFESELIGCPNTILTPHIGGSTLEAQENIAQFVP 530 + + +G +AGAA+DVF EP E+ L+ N I TPH+G ST EAQ N+A V Sbjct: 241 YEYMVNGKVAGAALDVFEVEPCT-----ENPLLQLENFIATPHLGASTEEAQINVAVDVA 295 Query: 531 GKIIEYINSGNTFNSVNFPNIQ-------LPFLKDAHRLIHIH-QNAPGVLAKINQV--- 579 +I+ + N+VN P++ PFL A +L Q G L K+ V Sbjct: 296 EEIVAALRGDLVKNAVNIPSMSPKLLAKVRPFLDLAEKLGKFQAQMLNGRLEKVEVVYSG 355 Query: 580 -LASYKIN 586 LA Y +N Sbjct: 356 ELARYDVN 363 Score = 33.1 bits (74), Expect = 3e-05 Identities = 21/92 (22%), Positives = 40/92 (43%), Gaps = 2/92 (2%) Query: 540 GNTFNSVNFPNIQLPFLKDAHRLIHIHQNAPGVLAKINQVLASYKINIVGQYLKTNEKIG 599 GN VN ++ H L+ H + P ++ K+ V+ INI G + E G Sbjct: 433 GNDPRIVNIDGYRINAATSGHMLVVPHIDKPRIVGKVGTVVGDKDINIAGMQVGRIELGG 492 Query: 600 --YVITDIDKRYSNDVIDALKEIEGTIRFRIL 629 ++ +D +D L +I+G + +++ Sbjct: 493 KAIMVMMVDNIVPQCAMDELAKIDGVLEVKMV 524 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 731 Number of extensions: 34 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 630 Length of database: 526 Length adjustment: 36 Effective length of query: 594 Effective length of database: 490 Effective search space: 291060 Effective search space used: 291060 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory