Align Aspartate--tRNA(Asp/Asn) ligase; EC 6.1.1.23; Aspartyl-tRNA synthetase; AspRS; Non-discriminating aspartyl-tRNA synthetase; ND-AspRS (uncharacterized)
to candidate WP_014026192.1 PYRFU_RS03160 aspartate--tRNA(Asn) ligase
Query= curated2:Q9Y9U7 (442 letters) >NCBI__GCF_000223395.1:WP_014026192.1 Length = 476 Score = 408 bits (1049), Expect = e-118 Identities = 220/455 (48%), Positives = 297/455 (65%), Gaps = 24/455 (5%) Query: 5 RFIADIIASKESLVGGRVRVCGWAYRIRDLGRLKFILVRDRSGVIQATVKRGESPEDALR 64 R+IAD++ +E VG + + GW +R G + F++VRDRSG +Q K+ + E A Sbjct: 29 RYIADVL--REGRVGEKYVIAGWVEAVRRHGGVVFVVVRDRSGRMQVVAKKNVARE-AWE 85 Query: 65 AAEDLKLESVVCVEGELRQAPTR-EGVEVKVERLEVLSTPVEPLPLEVEGSEKASLPTRL 123 A +L ESV+ V+G L ++ G E++ E + VL+ EPLP+E G + ASL RL Sbjct: 86 TARELSRESVIAVKGVLVESKAALGGKELQAEEILVLNE-AEPLPIE-PGGKTASLAIRL 143 Query: 124 KYRWLDIRNPMVSAIFELEAMVAKVFRDYYWSQGFVEIFTPKIVAAGTESGAEVFPVVYF 183 +YRW+D+R P + A+ A+ ++ QGF+EIFTPKIVA+ TE GAEVFP++YF Sbjct: 144 RYRWIDLREPRHATPIIAAAVAAEAASKFFAEQGFIEIFTPKIVASATEGGAEVFPIIYF 203 Query: 184 DKTAFLAQSPQFYKQFAVIAGLERVFEIGPVFRAEPHHTSRHLNEYHSLDIEVGFIESYN 243 +K AFLAQSPQ YKQ VI+GLERV+EIGP FRAE HHT RHL E+ S+D E+GFI+SY Sbjct: 204 EKEAFLAQSPQLYKQMGVISGLERVYEIGPAFRAEKHHTVRHLTEFTSVDFEMGFIKSYE 263 Query: 244 DVMNYVEGFMRAIVRMLEEDGRR---VLELYGVELPRIPASGIPKIPLRKAYEILEEKYG 300 DVM VEG + A++ ++ D R + E Y L P P++P+ +AY +L E G Sbjct: 264 DVMKVVEGAVTAMIEAIQSDPRTKPLLEEYYPQALELKPPREYPRVPIDEAYRLLREA-G 322 Query: 301 KKVEYGEDLDSEGERLMGAYAGEELDSDFVFIVEYPWKVRPFYTMRKDDEPSW------- 353 ++E EDL +EGE+ +G +E + VF+ YPW VRPFYTM+ +EP W Sbjct: 323 LEIEEDEDLGTEGEKKLGEIYEKEYGAPLVFVTMYPWSVRPFYTMKAREEP-WSCPEEPR 381 Query: 354 ------TYSFDLLYRGLEIVTGGQREHRYHRLLENLRDKGLDAESFQFYLDFFKHGAPPH 407 TYSFDLL++GLE+ TGGQREH L E LR+KGL+ +F +YL+ F+HGAPPH Sbjct: 382 FTNPKRTYSFDLLFKGLEVATGGQREHCPRILEEQLREKGLNPAAFDWYLEMFRHGAPPH 441 Query: 408 GGAGMGLERIVMQTLKLENIREARMLPRDTERITP 442 GGAG+GLER+VMQ L L NIREAR +PRD E + P Sbjct: 442 GGAGIGLERVVMQLLGLGNIREARFVPRDPEHLKP 476 Lambda K H 0.321 0.140 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 635 Number of extensions: 34 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 476 Length adjustment: 33 Effective length of query: 409 Effective length of database: 443 Effective search space: 181187 Effective search space used: 181187 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_014026192.1 PYRFU_RS03160 (aspartate--tRNA(Asn) ligase)
to HMM TIGR00458 (aspS: aspartate--tRNA(Asn) ligase (EC 6.1.1.23))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00458.hmm # target sequence database: /tmp/gapView.23655.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00458 [M=428] Accession: TIGR00458 Description: aspS_nondisc: aspartate--tRNA(Asn) ligase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-128 414.7 0.0 3.5e-128 414.1 0.0 1.2 1 lcl|NCBI__GCF_000223395.1:WP_014026192.1 PYRFU_RS03160 aspartate--tRNA(As Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000223395.1:WP_014026192.1 PYRFU_RS03160 aspartate--tRNA(Asn) ligase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 414.1 0.0 3.5e-128 3.5e-128 3 428 .] 31 476 .] 29 476 .] 0.91 Alignments for each domain: == domain 1 score: 414.1 bits; conditional E-value: 3.5e-128 TIGR00458 3 sadi.keekdgkevllrgwvheirdlGalifvllrdregliqilvkkkkvskelfklikklkkesvvav 70 ad+ e + g++ ++ gwv +r G+++fv++rdr g +q+++kk v +e +++++l +esv+av lcl|NCBI__GCF_000223395.1:WP_014026192.1 31 IADVlREGRVGEKYVIAGWVEAVRRHGGVVFVVVRDRSGRMQVVAKK-NVAREAWETARELSRESVIAV 98 56651445667999****************************98876.588999*************** PP TIGR00458 71 kGkvkekekapqgleiipeklevlneakeplPldleekveaeldtrldarfldlrrpkvqaifkirsev 139 kG + e+++a +g e+ e++ vlnea eplP+++ k+ a l rl +r +dlr+p+ + + lcl|NCBI__GCF_000223395.1:WP_014026192.1 99 KGVLVESKAALGGKELQAEEILVLNEA-EPLPIEPGGKT-ASLAIRLRYRWIDLREPRHATPIIAAAVA 165 *************************98.6******9995.899**************987776666677 PP TIGR00458 140 lesvreflaeegfievntPklvasateGGtelfeityfereaflaqsPqlykqvllaaglervyeiaPi 208 e+ +f+ae+gfie+ tPk+vasateGG+e+f+i yfe+eaflaqsPqlykq+ + +glervyei+P lcl|NCBI__GCF_000223395.1:WP_014026192.1 166 AEAASKFFAEQGFIEIFTPKIVASATEGGAEVFPIIYFEKEAFLAQSPQLYKQMGVISGLERVYEIGPA 234 89999**************************************************************** PP TIGR00458 209 fraeehntkrhlnevisidiemafedh.kdvldileelvvrvfedvaeklkk.....elevlevklevp 271 frae+h+t rhl+e++s+d em f + +dv++++e v+ ++e ++ ++ e+ + ++l +p lcl|NCBI__GCF_000223395.1:WP_014026192.1 235 FRAEKHHTVRHLTEFTSVDFEMGFIKSyEDVMKVVEGAVTAMIEAIQSDPRTkplleEYYPQALEL-KP 302 ************************9998*****************998765535544344444444.47 PP TIGR00458 272 eeklerltydeaieilrakGkeikdgedlsteaekllGekmdgly.....fitdfPteikPfytm.... 331 + +++r+ dea +lr +G ei++ edl te ek lGe+++ +y f+t +P ++Pfytm lcl|NCBI__GCF_000223395.1:WP_014026192.1 303 PREYPRVPIDEAYRLLREAGLEIEEDEDLGTEGEKKLGEIYEKEYgaplvFVTMYPWSVRPFYTMkare 371 899***********************************9999988777779**************5555 PP TIGR00458 332 .....Pde...dnPeisksfdllyrdleissGaqrihdydllvekikakGlePeslksyleafkyGmPP 392 P+e nP+++ sfdll+++le+++G qr h +l e++++kGl+P +++ yle f++G PP lcl|NCBI__GCF_000223395.1:WP_014026192.1 372 epwscPEEprfTNPKRTYSFDLLFKGLEVATGGQREHCPRILEEQLREKGLNPAAFDWYLEMFRHGAPP 440 544442223336899****************************************************** PP TIGR00458 393 haGwGlGaerlvmvlldlknireavlfPrdrkrltP 428 h G G+G+er+vm ll+l nirea + Prd++ l+P lcl|NCBI__GCF_000223395.1:WP_014026192.1 441 HGGAGIGLERVVMQLLGLGNIREARFVPRDPEHLKP 476 *********************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (428 nodes) Target sequences: 1 (476 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 12.58 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory