Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (uncharacterized)
to candidate WP_014026250.1 PYRFU_RS03470 homoserine kinase
Query= curated2:Q9YA72 (313 letters) >NCBI__GCF_000223395.1:WP_014026250.1 Length = 318 Score = 162 bits (409), Expect = 1e-44 Identities = 108/296 (36%), Positives = 152/296 (51%), Gaps = 13/296 (4%) Query: 4 SRARARAYSSAANLGPGFDALAVALDAYYDEVEVRVCSG-GNSVYVDEVEGKFSSGVLQG 62 +R R +A +S ANLGP FD A+A+D YD VEV V G+ + VD SG Sbjct: 5 NRVRVKAPASIANLGPLFDLAALAIDYAYDVVEVEVVEELGDGIRVDVEAAGAPSGEA-- 62 Query: 63 PNTAAEAVRGLLNMEGVEAEVGIRVYKGVPPGRGLGSSGASAAAAVAAVSHALALEVPVD 122 NTA A +L G + IRV KGVPP G+G SGASAAAA AV+ L + Sbjct: 63 -NTAYTAAYKILEYLGETLHLRIRVVKGVPPRMGMGGSGASAAAAAYAVNLLLGEPFTKE 121 Query: 123 RLVFYAGLGERAAAGQPHFDNAAASILGGLAVVASDAAGKLRVFRVPFKAWFAVVTPMN- 181 LV +AG E AAG PH+DN AAS+LGGL ++ + + +P + + P Sbjct: 122 ELVKFAGEAEAVAAGTPHYDNVAASLLGGLVILLDRSRPWVARLNIPEDVYIILFIPKRE 181 Query: 182 ----PVPQGKTGVMRKVLPENVSFRDAVRNFSRAAGIVAAAVNGDLKSMGALMMSDEIVE 237 P +GKT VMR+VLP + ++ +A + ++ A VE Sbjct: 182 VVKVPPGKGKTEVMREVLPREIPLATSIAWMEKALALTLGLQLDPYTALKAANYGGP-VE 240 Query: 238 PRRRSYVPCYTQVRKAALQAGALGFSLSGAGPSMIAL---APSSEAAREIAAAMEE 290 R +P Y + ++ AL+AGAL F++SGAGP++ A+ E AR +A +E+ Sbjct: 241 EARSKLIPGYAEAKREALEAGALAFNISGAGPTLFAIVREGDEDEVARRVAKILEK 296 Lambda K H 0.317 0.131 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 318 Length adjustment: 27 Effective length of query: 286 Effective length of database: 291 Effective search space: 83226 Effective search space used: 83226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_014026250.1 PYRFU_RS03470 (homoserine kinase)
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00191.hmm # target sequence database: /tmp/gapView.28673.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00191 [M=304] Accession: TIGR00191 Description: thrB: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-56 176.1 0.0 4.4e-56 175.9 0.0 1.0 1 lcl|NCBI__GCF_000223395.1:WP_014026250.1 PYRFU_RS03470 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000223395.1:WP_014026250.1 PYRFU_RS03470 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 175.9 0.0 4.4e-56 4.4e-56 1 302 [. 7 316 .. 7 318 .] 0.91 Alignments for each domain: == domain 1 score: 175.9 bits; conditional E-value: 4.4e-56 TIGR00191 1 lkvkvPassANlgpGfDvlGlalslvlellvtedvaqeskdksleaegegvekipkesdkNliyqvakk 69 ++vk+Pas ANlgp fD la+ ++++ +e+ e d ++ +e ++ p+ ++N +y +a+k lcl|NCBI__GCF_000223395.1:WP_014026250.1 7 VRVKAPASIANLGPLFDLAALAIDYAYDVVEVEV-VEELGDG-IRVDVEA-AGAPSG-EANTAYTAAYK 71 69*************************9999993.3444444.8888888.889999.9********** PP TIGR00191 70 vlkklgkrvkpvkltvekeiplgrGLGSSaaaivaaviaanelaglklskeelldlalllEg......H 132 +l+ lg+ ++++v k +p G+G S+a+ +aa++a+n l+g++++keel+++a++ E H lcl|NCBI__GCF_000223395.1:WP_014026250.1 72 ILEYLGET-LHLRIRVVKGVPPRMGMGGSGASAAAAAYAVNLLLGEPFTKEELVKFAGEAEAvaagtpH 139 *******9.99********************************************************** PP TIGR00191 133 pDNvapallGGlqlavkedd.llevlkvPsgsklkvvlviPniev........sTaeaRavLPkaysrq 192 +DNva++llGGl++ + + + l++P ++++++l iP++ev +T+ R+vLP++ +++ lcl|NCBI__GCF_000223395.1:WP_014026250.1 140 YDNVAASLLGGLVILLDRSRpWVARLNIP--EDVYIILFIPKREVvkvppgkgKTEVMREVLPREIPLA 206 ****************9998678889999..89**********996656665569************** PP TIGR00191 193 dlvfnlshlavlvtAlvskdkadllaiamkDrvhqpyRekliPelteikqaakekgalgitlSGaGpti 261 +++ ++++ l+ l ++ + l a + R+kliP+++e k++a e+gal+ +SGaGpt+ lcl|NCBI__GCF_000223395.1:WP_014026250.1 207 TSIAWMEKALALTLGLQLDPYTALKAANYGG-PVEEARSKLIPGYAEAKREALEAGALAFNISGAGPTL 274 *******************776666655555.55778******************************** PP TIGR00191 262 lalaeeek.eekaqelleklakegieltvkvleldtdgaeve 302 +a+ +e + +e a ++ + l k+ el+ +v+++d +ga+++ lcl|NCBI__GCF_000223395.1:WP_014026250.1 275 FAIVREGDeDEVARRVAKILEKHWGELETRVVNIDREGARIT 316 ********66666667777788899**************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (318 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.18 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory