Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_006749008.1 THITH_RS04655 homoserine dehydrogenase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_000227685.2:WP_006749008.1 Length = 437 Score = 196 bits (499), Expect = 2e-54 Identities = 146/413 (35%), Positives = 215/413 (52%), Gaps = 23/413 (5%) Query: 17 VRKVRVGIAGLGTVGGSIYRILKERGNEIEKRIGEKFIISKVINRSPQKYELLGVPKEEI 76 ++ V++G+ GLGTVG +L EI +R G + R + G E + Sbjct: 1 MKPVKIGLLGLGTVGCGTVDVLDRNAGEIARRAGRGIAVVAAAVRDLARPR--GCALEGV 58 Query: 77 AFDFDDLILNSD----VVVEAIGGTDVAVDLVRRALELGRIVVTPNKNLISEYGNEFSEY 132 D + + D VVVE +GGT+ A +LV RA+ G+ VVT NK LI+ +GNE Sbjct: 59 RLTADPVAVVDDPEVEVVVELMGGTEPARELVLRAIAAGKHVVTANKALIALHGNEIFAR 118 Query: 133 IKKRKLF--FEASVGGGIPIISLLQDYLIFQKVTRIRGIMNGTTNYILTEM-SKGRHFEE 189 +R + FEA+V GGIPII L++ L ++ + GI+NGT N+ILTEM GR F + Sbjct: 119 AHERGVMVAFEAAVAGGIPIIKALREGLAGNRIEWVAGIINGTGNFILTEMRDHGRDFAD 178 Query: 190 VLKEAQELGYAEADPTNDIEGYDVAYKVSVLAGVVTG---RFPGINSVQFEGITRIDPEY 246 VL EAQ LGYAEADPT D+EG D A+K+ +LA + G +F ++ GITR D + Sbjct: 179 VLAEAQRLGYAEADPTFDVEGIDAAHKLCILAAIAFGIPLQFDRVHVEGISGITREDVTF 238 Query: 247 LKEIVRSGKKLKLIGELDFSTNRYEVRLR-EVTPEDPFF-NVDGVDNAIEVSTDLAGDFL 304 E+ G ++K +G + +E+R+ + PE NVDGV NA+ V D G L Sbjct: 239 AGEL---GYRIKHLGIARRAEGGFELRVHPTLIPERRLIANVDGVMNAVLVKGDAVGPTL 295 Query: 305 LKGRGAGGYPTASAVIADLFRVAKYKVLGGAEKFSVVVMKFGGAAISD--VEKLEKVAEK 362 G GAG TASAV+ADL V + L + V + F A+SD + + +V Sbjct: 296 YYGAGAGADATASAVVADLVDVV--RALTADPENRVPHLAFQPDALSDQPILPMAEVRTS 353 Query: 363 IIKRKKSGVKPVVVLSAMGDTTDHLIELAKTIDENPDP--RELDLLLSTGEIQ 413 R ++ +P V+ H I + + PDP E +++ T +++ Sbjct: 354 FYLRLRACDRPGVLADIARVLGQHSISIEALLQREPDPDRGEATIIILTHQVR 406 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 754 Number of extensions: 44 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 437 Length adjustment: 36 Effective length of query: 703 Effective length of database: 401 Effective search space: 281903 Effective search space used: 281903 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory