Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_006747933.1 THITH_RS11500 aminotransferase class V-fold PLP-dependent enzyme
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_000227685.2:WP_006747933.1 Length = 386 Score = 271 bits (692), Expect = 3e-77 Identities = 157/379 (41%), Positives = 216/379 (56%), Gaps = 4/379 (1%) Query: 5 VALRAG-VPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLG 63 ++ RAG + PF VM + A ER+ D+++L G+P P P+ AAA AL + Sbjct: 4 LSARAGALEPFRVMQILAQAQEREAEGTDVIHLEVGEPDFPTPAPIVAAAQRALAGGRTR 63 Query: 64 YSVALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASP 123 Y+ A G LR AIAADY+R G+ ++P+ VV+T G+S LLA A D GDRV + P Sbjct: 64 YTAAHGSAALRAAIAADYRRGFGVDLDPERVVVTAGASAAILLALAAGTDPGDRVLLPDP 123 Query: 124 GYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAEI-DPPLRGVVVASPANPTGTVIPP 182 GY C R + ALG +P + FQPTA +A R V++ASP+NPTGT++ Sbjct: 124 GYACNRQFVHALGARADLLPVTAEQDFQPTANHVAAAWRSDTRAVMLASPSNPTGTLLSA 183 Query: 183 EELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWR 242 +AAIA A LI DE+Y LV+ PQT A + +AV++NSFSKYYAMTGWR Sbjct: 184 SGIAAIAEAVRARGGVLIVDEIYGRLVFDSPPQT--ALSVAPDAVILNSFSKYYAMTGWR 241 Query: 243 LGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLL 302 LGW++VP V L N + P L+Q AA++AF PE A + A R LL Sbjct: 242 LGWMVVPEHWIEPVRRLAQNLFVAPSTLAQEAALAAFEPETDALLQARVRELAERRDFLL 301 Query: 303 DGLRRIGIDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSF 362 + L +G+ A GAFY+YAD + + +DS C++LL + VA+ PG DF A G Sbjct: 302 EALPSLGLPVRARPGGAFYLYADSTGYGADSEQLCARLLREAAVALTPGTDFSPAGGRDH 361 Query: 363 VRISFAGPSGDIEEALRRI 381 VRI++ P + EA+ R+ Sbjct: 362 VRIAYTQPRDRLAEAVARM 380 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 468 Number of extensions: 31 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 386 Length adjustment: 30 Effective length of query: 358 Effective length of database: 356 Effective search space: 127448 Effective search space used: 127448 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory