Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_043537101.1 SACCYDRAFT_RS06020 branched-chain amino acid aminotransferase
Query= BRENDA::A0R066 (368 letters) >NCBI__GCF_000244975.1:WP_043537101.1 Length = 367 Score = 504 bits (1298), Expect = e-147 Identities = 245/363 (67%), Positives = 292/363 (80%), Gaps = 2/363 (0%) Query: 6 LEFTVSANTNPATDAVRESILANPGFGKYYTDHMVSIDYTVDEGWHNAQVIPYGPIQLDP 65 + F+ S +T PA+ +LA PGFG ++TDHM ++ +T GWH+A++ Y P+ LDP Sbjct: 5 IPFSHSPSTRPASAERVAEVLAKPGFGVHFTDHMATVKWTKGTGWHDAELRAYEPVSLDP 64 Query: 66 SAIVLHYGQEIFEGLKAYRWADGSIVSFRPEANAARLQSSARRLAIPELPEEVFIESLRQ 125 + VLHYGQ IFEGLKAYR DG++ +FRP+ NAAR + SARRLA+PELP+E+F+ S+R+ Sbjct: 65 ATAVLHYGQAIFEGLKAYRQPDGTVKAFRPDVNAARFRRSARRLAMPELPDELFLGSIRE 124 Query: 126 LIAVDEKWVPPAGGEESLYLRPFVIATEPGLGVR-PSNEYRYLLIASPAGAYFKGGIKPV 184 LIA DE+WVP G+ SLYLRPF+IATE GLGV PS+ Y Y+LIASPAG+YF GG+KPV Sbjct: 125 LIAADERWVPTRQGD-SLYLRPFLIATEAGLGVNSPSSSYLYMLIASPAGSYFTGGVKPV 183 Query: 185 SVWLSHEYVRASPGGTGAAKFGGNYAASLLAQAQAAEMGCDQVVWLDAIERRYVEEMGGM 244 SVWLS EYVRA+PGGTG AK GNYAAS +AQAQA E GCDQVVWLDA ERRYVEEMGGM Sbjct: 184 SVWLSTEYVRAAPGGTGEAKCAGNYAASFVAQAQAVEQGCDQVVWLDANERRYVEEMGGM 243 Query: 245 NLFFVFGSGGSARLVTPELSGSLLPGITRDSLLQLATDAGFAVEERKIDVDEWQKKAGAG 304 NLFFVFGSG AR+VTPELSGSLLPG+TRDSLL+LA+D G+ VEER+I DEW+K A +G Sbjct: 244 NLFFVFGSGSDARVVTPELSGSLLPGVTRDSLLRLASDFGYRVEERRITTDEWEKTASSG 303 Query: 305 EITEVFACGTAAVITPVSHVKHHDGEFTIADGQPGEITMALRDTLTGIQRGTFADTHGWM 364 E+TEVFACGTAAVITPV HVKH GEF++ DG PGEITM LR+ LTGIQ GT D HGWM Sbjct: 304 ELTEVFACGTAAVITPVGHVKHAGGEFSVGDGSPGEITMKLREELTGIQEGTRPDPHGWM 363 Query: 365 ARL 367 L Sbjct: 364 YTL 366 Lambda K H 0.318 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 367 Length adjustment: 30 Effective length of query: 338 Effective length of database: 337 Effective search space: 113906 Effective search space used: 113906 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_043537101.1 SACCYDRAFT_RS06020 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01123.hmm # target sequence database: /tmp/gapView.17447.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-138 446.7 0.0 2.1e-138 446.5 0.0 1.0 1 lcl|NCBI__GCF_000244975.1:WP_043537101.1 SACCYDRAFT_RS06020 branched-chai Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000244975.1:WP_043537101.1 SACCYDRAFT_RS06020 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 446.5 0.0 2.1e-138 2.1e-138 1 312 [. 49 365 .. 49 366 .. 0.98 Alignments for each domain: == domain 1 score: 446.5 bits; conditional E-value: 2.1e-138 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeel 69 W++ael+++++++ld+++avlhYgq++feGlkayR+ dG + fRpd na+R+rrsa+rl++Pel++el lcl|NCBI__GCF_000244975.1:WP_043537101.1 49 WHDAELRAYEPVSLDPATAVLHYGQAIFEGLKAYRQPDGTVKAFRPDVNAARFRRSARRLAMPELPDEL 117 ********************************************************************* PP TIGR01123 70 flealkqlvkadkdwvpkakseasLYlRPfliatednlGvk.aakeylflvlasPvGaYfkgglapvsi 137 fl ++++l++ad++wvp+ + + sLYlRPfliate+ lGv+ ++++yl++++asP+G+Yf gg++pvs+ lcl|NCBI__GCF_000244975.1:WP_043537101.1 118 FLGSIRELIAADERWVPTRQ-GDSLYLRPFLIATEAGLGVNsPSSSYLYMLIASPAGSYFTGGVKPVSV 185 *****************887.9******************73577************************ PP TIGR01123 138 fveteyvRaapkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdg.. 204 +++teyvRaap+GtG +k++GnYaas+ aq++a eqg+d+vv+ld++e++++ee+G++n+f++ ++g lcl|NCBI__GCF_000244975.1:WP_043537101.1 186 WLSTEYVRAAPGGTGEAKCAGNYAASFVAQAQAVEQGCDQVVWLDANERRYVEEMGGMNLFFVFGSGsd 254 ****************************************************************99987 PP TIGR01123 205 .elvttplsesiLegvtresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgel 270 ++vt++ls+s+L+gvtr+sll+la d g++veer+i+ de+++++ +Ge+ vfacGtaavitPvg++ lcl|NCBI__GCF_000244975.1:WP_043537101.1 255 aRVVTPELSGSLLPGVTRDSLLRLASDFGYRVEERRITTDEWEKTASSGELteVFACGTAAVITPVGHV 323 789***********************************************999**************** PP TIGR01123 271 kiegkevevkseevGevtkklrdeltdiqyGkledkegWive 312 k+ g e++v ++ +Ge+t+klr+elt+iq G+ d++gW+ lcl|NCBI__GCF_000244975.1:WP_043537101.1 324 KHAGGEFSVGDGSPGEITMKLREELTGIQEGTRPDPHGWMYT 365 ***************************************975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (367 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.36 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory