Align Cystathionine gamma-synthase; CGS; EC 2.5.1.48; O-succinylhomoserine (thiol)-lyase (uncharacterized)
to candidate WP_041773934.1 LFE_RS02030 PLP-dependent transferase
Query= curated2:Q1M0P5 (380 letters) >NCBI__GCF_000284315.1:WP_041773934.1 Length = 402 Score = 290 bits (743), Expect = 4e-83 Identities = 165/385 (42%), Positives = 234/385 (60%), Gaps = 15/385 (3%) Query: 4 QTKLIHGGISEDATTGAVSVPIYQTSTY------RQDAI--GHHKGYEYSRSGNPTRFAL 55 +TK IH ED A++ P+YQTST+ + D + G +G+ Y R GNPT Sbjct: 17 RTKCIHTSGPEDPWR-ALTPPLYQTSTFTFPDFDQVDRVLKGEEEGFVYGRMGNPTTERF 75 Query: 56 EELIADLEGGVKGFAFASGLAGIHAVF-SLLQSGDHVLLGDDVYGGTFRLFNKVLVKNGL 114 E L+++LEGG K AFASG+ I A+ L +S + +YGGT K L+ G Sbjct: 76 ETLVSELEGGEKTRAFASGMGAISAILIHLTKSRPEMAFPKVLYGGTRAFIEKYLIPQGC 135 Query: 115 SCTIIDTSDLS---QIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIVDN 171 D + ++ + + P T A++ ETPSNP++ + DL + + +AK G+ +VDN Sbjct: 136 LIHWFDPREEGWGEELSRRLSPKTAAVFAETPSNPVMTVIDLGRLSGIAKSAGVPLVVDN 195 Query: 172 TFATPYYQNPLLLGADIVVHSGTKYLGGHSDVVAGLVTTNNEALAQEIAFFQNA-IGGVL 230 TFATP Q PL LGADIVVHS TKYLGGH D++ G VT N +L + ++F + + +G L Sbjct: 196 TFATPILQKPLALGADIVVHSATKYLGGHGDLLGGTVT-GNASLMERLSFEEGSYLGATL 254 Query: 231 GPQDSWLLQRGIKTLGLRMQAHQKNALCVAEFLEKHPKVERVYYPGLPTHPNYELAKKQM 290 P SWLL RG+KTL LRM+AH + A+ +AEFL HP V+ V+YPGLP P +++A QM Sbjct: 255 SPFHSWLLLRGMKTLPLRMEAHCRGAMNIAEFLSHHPMVKSVHYPGLPGDPGHKVAALQM 314 Query: 291 RGFSGMLSFTLKNDSEATPFVESLKLFILGESLGGVESLVGVPAFMTHACIPKTQREAAG 350 +GF GMLSF+L +D +A L+ F + SLG ESL+ PA ++H + R A G Sbjct: 315 KGFGGMLSFSLGDDQKARKVASRLEFFKIAVSLGDPESLIEHPASLSHRQMSPEGRMALG 374 Query: 351 IRDGLVRLSVGIEHEQDLLEDLEQA 375 I G +R+SVG+E +DL+ DL++A Sbjct: 375 IDPGFLRVSVGLEDPEDLILDLKRA 399 Lambda K H 0.318 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 428 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 402 Length adjustment: 31 Effective length of query: 349 Effective length of database: 371 Effective search space: 129479 Effective search space used: 129479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory