Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95 (uncharacterized)
to candidate WP_014449144.1 LFE_RS04870 2-hydroxyacid dehydrogenase
Query= curated2:Q58424 (524 letters) >NCBI__GCF_000284315.1:WP_014449144.1 Length = 333 Score = 136 bits (342), Expect = 1e-36 Identities = 90/280 (32%), Positives = 148/280 (52%), Gaps = 27/280 (9%) Query: 56 DVIEKAEKLKVIGRAGV--------GVDNIDVEAATEKGIIVVNAPDASSISVAELTMGL 107 D + A LK + + G G +++D+++A + I V+ D S SVAE ++GL Sbjct: 52 DDVLNATVLKTLAKGGTRLLALRSTGFNHVDLDSAQKLHITVMRVQDYSPYSVAEFSLGL 111 Query: 108 MLAAARNIPQATASLKRGEWDRKRFKGIELYGKTLGVIGLGRIGQQVVKRAKAFGMNIIG 167 ML R++ +A ++ + G +++GKT+G++G G+IG V K G +++G Sbjct: 112 MLMLNRHLHKAYNRVREENFLLDGLMGFDMHGKTVGIVGTGKIGFSVAKILNGMGCSLLG 171 Query: 168 YDPYIPKEVAESMGVELVDDINELCKRADFITLHVPLTPKTRHIIGREQIALMKKNAIIV 227 +D + + ++G+ VD ++ L ++ TLH+PLTP+T H+I + M AI++ Sbjct: 172 HDLWENPQCL-ALGMNYVD-LDTLLSQSQITTLHLPLTPQTYHLINATTLQKMPDCAILI 229 Query: 228 NCARGGLIDEKALYEALKEGKIRAAALDVFEEE--------------PPKDNPLLTLDNV 273 N +RG LID +AL EALK ++ A LDV+EEE + LLT NV Sbjct: 230 NTSRGALIDTRALIEALKAKRLGGAGLDVYEEETGLYFKNFSDEIITDDLFSRLLTFPNV 289 Query: 274 IGTPHQGASTEEAQKAAGTIVAEQIKKVLRGELAENVVNM 313 I T HQ T EA + TI A I+ + E+ + +N+ Sbjct: 290 IVTGHQAFFTREAME---TIAATTIQNLSDFEIGKTNINI 326 Lambda K H 0.316 0.137 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 524 Length of database: 333 Length adjustment: 31 Effective length of query: 493 Effective length of database: 302 Effective search space: 148886 Effective search space used: 148886 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory