Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate WP_014448409.1 LFE_RS00950 branched-chain amino acid transaminase
Query= reanno::BFirm:BPHYT_RS16285 (307 letters) >NCBI__GCF_000284315.1:WP_014448409.1 Length = 311 Score = 351 bits (900), Expect = e-101 Identities = 170/294 (57%), Positives = 216/294 (73%), Gaps = 1/294 (0%) Query: 10 IWMDGKLIDWRDAKIHVLTHTLHYGMGVFEGVRAYKTADGGTAIFRLQEHTKRLLNSAKI 69 IWMDGK++ W+DA +HVLTH+LHYGM VFEG+RAY +G T+IFRL EHT+RL+NS K+ Sbjct: 8 IWMDGKMVPWKDANVHVLTHSLHYGMAVFEGIRAYSGPEG-TSIFRLAEHTRRLVNSGKV 66 Query: 70 FQMDVPFDHETLAAAQCEVVRENKLESCYLRPIIWVGSEKLGVSAKGNTIHVAIAAWPWG 129 M P+ E L A C VVREN L SCY+RP+++VG +G+ A+ N I V+I+AW WG Sbjct: 67 MLMKSPYSEEELMDATCRVVRENNLSSCYIRPLMYVGYGDMGIYARQNPICVSISAWEWG 126 Query: 130 AYLGEDGIAKGIRVKTSSFTRHHVNVSMVRAKASGWYVNSILANQEAIADGYDEALLLDV 189 YLGE+G++KGIR K SSF+R VN + RAK S YVNS LA E GYDEA+LLD Sbjct: 127 TYLGEEGLSKGIRAKISSFSRFGVNTFLNRAKVSAHYVNSQLAKWEVKMAGYDEAILLDQ 186 Query: 190 DGYVSEGSGENFFLVNNGKLYTPDLSSCLDGITRDTVITLARDAGIQVIEKRITRDEVYT 249 DG+V+EG GEN F+V+ G L TP L + LDGITR+ V TLA++ GI V E +TRD++Y Sbjct: 187 DGFVAEGPGENIFIVSGGVLRTPALKTVLDGITRNAVQTLAKEMGIPVWEGVLTRDDLYL 246 Query: 250 CDEAFFTGTAAEVTPIRELDNRTIGSGARGPITEKLQSGFFDIVNGKSDKYANW 303 DEAFFTGTAAE+TPIRE+D RTIG+G GP+T LQ FFD+V+G ++ W Sbjct: 247 ADEAFFTGTAAELTPIREIDERTIGTGRPGPVTLALQKAFFDVVHGHVKDHSEW 300 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 311 Length adjustment: 27 Effective length of query: 280 Effective length of database: 284 Effective search space: 79520 Effective search space used: 79520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_014448409.1 LFE_RS00950 (branched-chain amino acid transaminase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.27176.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-132 426.3 0.0 3.2e-132 426.2 0.0 1.0 1 lcl|NCBI__GCF_000284315.1:WP_014448409.1 LFE_RS00950 branched-chain amino Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000284315.1:WP_014448409.1 LFE_RS00950 branched-chain amino acid transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 426.2 0.0 3.2e-132 3.2e-132 1 297 [. 9 303 .. 9 304 .. 0.99 Alignments for each domain: == domain 1 score: 426.2 bits; conditional E-value: 3.2e-132 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipyskee 69 w+dG++v+++da+vhvlth+lhYG++vfeGiRaY++++g+ ifrl eh+ Rl +s k++ ++ pys+ee lcl|NCBI__GCF_000284315.1:WP_014448409.1 9 WMDGKMVPWKDANVHVLTHSLHYGMAVFEGIRAYSGPEGTSIFRLAEHTRRLVNSGKVMLMKSPYSEEE 77 9******************************************************************** PP TIGR01122 70 lvevtkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvssf 138 l+++t v+r+nnl+s+YiRpl+yvG++d+g++++ + ++ v i awewg+ylgee+l+kGi++k+ssf lcl|NCBI__GCF_000284315.1:WP_014448409.1 78 LMDATCRVVRENNLSSCYIRPLMYVGYGDMGIYARQN-PICVSISAWEWGTYLGEEGLSKGIRAKISSF 145 **********************************655.9****************************** PP TIGR01122 139 rraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvses 207 r vn++ ++ak+++ Y+ns+lak e ++aGydeailLd++G+vaeG+Genifiv+ gvl tP + ++ lcl|NCBI__GCF_000284315.1:WP_014448409.1 146 SRFGVNTFLNRAKVSAHYVNSQLAKWEVKMAGYDEAILLDQDGFVAEGPGENIFIVSGGVLRTPAL-KT 213 ******************************************************************.77 PP TIGR01122 208 iLkgitrdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkkl 276 +L+gitr+av +lake+gi v e +++r++ly+aDe+f+tGtaae+tPire+D+r+ig g+ Gpvt l lcl|NCBI__GCF_000284315.1:WP_014448409.1 214 VLDGITRNAVQTLAKEMGIPVWEGVLTRDDLYLADEAFFTGTAAELTPIREIDERTIGTGRPGPVTLAL 282 ********************************************************************* PP TIGR01122 277 qeaffdlvegktekkeewlty 297 q+affd+v+g++++++ew + lcl|NCBI__GCF_000284315.1:WP_014448409.1 283 QKAFFDVVHGHVKDHSEWRYP 303 ******************866 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (311 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.54 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory