Align ketol-acid reductoisomerase (NADP+) (EC 1.1.1.86) (characterized)
to candidate WP_017598159.1 D471_RS0108140 ketol-acid reductoisomerase
Query= BRENDA::A0A0K2AZ61 (332 letters) >NCBI__GCF_000341125.1:WP_017598159.1 Length = 327 Score = 474 bits (1220), Expect = e-138 Identities = 230/325 (70%), Positives = 269/325 (82%) Query: 4 LFYDADADLSIIQGRKVAVIGYGSQGHAHALSLRDSGVDVRVGLHEGSKSKAKAEEQGLR 63 ++YD ADL +IQ +KVAVIGYGSQGHAHALSLRDSGVDVR+GL EGSKS+AKAEE+GLR Sbjct: 1 MYYDDAADLELIQSKKVAVIGYGSQGHAHALSLRDSGVDVRIGLAEGSKSRAKAEEEGLR 60 Query: 64 VVSPSEAAAEADVIMILVPDPIQAQVYEEHIKDNLKDGDALFFGHGLNIRFGFIKPPAGV 123 V++P+EAA EADVIMILVPD I +Y I NL+ G+ALFFGHG +IR+G I PP GV Sbjct: 61 VLTPAEAAREADVIMILVPDHIHRDLYANEIAPNLEAGNALFFGHGFSIRYGLITPPEGV 120 Query: 124 DVCMVAPKGPGHLVRRQYEEGRGVPCIAAVEQDASGNAFALALSYAKGIGGTRAGVIKTT 183 DV MVAPKGPGHLVRRQYE GRGVPC+ AVE+DASG A+ LALS+AKGIGGT+AGVIKTT Sbjct: 121 DVAMVAPKGPGHLVRRQYEAGRGVPCLVAVEKDASGQAWDLALSWAKGIGGTKAGVIKTT 180 Query: 184 FTEETETDLFGEQAVLCGGTAALVKAGFETLTEAGYQPEIAYFECLHELKLIVDLMYEGG 243 FTEETETDLFGEQAVLCGGT LVKAGF TL EAGYQPEIAYFECLHELKLIVDLMYEGG Sbjct: 181 FTEETETDLFGEQAVLCGGTEELVKAGFATLVEAGYQPEIAYFECLHELKLIVDLMYEGG 240 Query: 244 LEKMRWSISETAEWGDYVTGPRIITDATKAEMKKVLAEIQDGTFAKNWMDEYHGGLKKYN 303 + KM WS+S+ AE+G Y GPR+IT+ T+ EM+K+L EIQDG++AK MDE+ G + Sbjct: 241 ISKMNWSVSDNAEYGGYTRGPRVITEQTREEMRKILREIQDGSYAKELMDEFDAGQPTFT 300 Query: 304 EYKQQDSEHLLETTGKQLRKLMSWV 328 + ++ + +E G QLR LMSW+ Sbjct: 301 KRREAEQNEPIEKVGAQLRPLMSWL 325 Lambda K H 0.316 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 327 Length adjustment: 28 Effective length of query: 304 Effective length of database: 299 Effective search space: 90896 Effective search space used: 90896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_017598159.1 D471_RS0108140 (ketol-acid reductoisomerase)
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00465.hmm # target sequence database: /tmp/gapView.30299.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00465 [M=314] Accession: TIGR00465 Description: ilvC: ketol-acid reductoisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-135 436.8 0.0 2.2e-135 436.6 0.0 1.0 1 lcl|NCBI__GCF_000341125.1:WP_017598159.1 D471_RS0108140 ketol-acid reduct Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000341125.1:WP_017598159.1 D471_RS0108140 ketol-acid reductoisomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 436.6 0.0 2.2e-135 2.2e-135 1 313 [. 12 325 .. 12 326 .. 0.99 Alignments for each domain: == domain 1 score: 436.6 bits; conditional E-value: 2.2e-135 TIGR00465 1 lkgkkvaiiGyGsqGeaqalnlrdsglnvivglrkeaaswkkAeedGfkvltveeaikkadlimiLlpD 69 +++kkva+iGyGsqG+a+al lrdsg++v++gl ++++s +kAee+G++vlt +ea+++ad+imiL+pD lcl|NCBI__GCF_000341125.1:WP_017598159.1 12 IQSKKVAVIGYGSQGHAHALSLRDSGVDVRIGLAEGSKSRAKAEEEGLRVLTPAEAAREADVIMILVPD 80 689****************************************************************** PP TIGR00465 70 evqkevyeaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsliA 138 +++++ y +ei+p+l++g+al f HGf+i + i++p++vdv++vAPKgpG+lvR++y+ grGvp l+A lcl|NCBI__GCF_000341125.1:WP_017598159.1 81 HIHRDLYANEIAPNLEAGNALFFGHGFSIRYGLITPPEGVDVAMVAPKGPGHLVRRQYEAGRGVPCLVA 149 ********************************************************************* PP TIGR00465 139 veqdvtgeakeiAlayAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyqp 207 ve+d++g+a + Al++Ak+iGg++agv++ttF eE+e+DLfGEqavLcGg e+l+ka+f tLveaGyqp lcl|NCBI__GCF_000341125.1:WP_017598159.1 150 VEKDASGQAWDLALSWAKGIGGTKAGVIKTTFTEETETDLFGEQAVLCGGTEELVKAGFATLVEAGYQP 218 ********************************************************************* PP TIGR00465 208 elAyfeivhelklivdllkekGlelmrdavsntAklgalelr.eilkeelkkemqkilkeiqnGefake 275 e+Ayfe++helklivdl++e+G+++m +vs+ A++g+++++ ++++e++++em+kil eiq+G++ake lcl|NCBI__GCF_000341125.1:WP_017598159.1 219 EIAYFECLHELKLIVDLMYEGGISKMNWSVSDNAEYGGYTRGpRVITEQTREEMRKILREIQDGSYAKE 287 ********************************************************************* PP TIGR00465 276 walekeagkpafeearkkekeqeiekvGkelralvkae 313 + e+ ag+p+f++ r++e+++ iekvG +lr l+++ lcl|NCBI__GCF_000341125.1:WP_017598159.1 288 LMDEFDAGQPTFTKRREAEQNEPIEKVGAQLRPLMSWL 325 **********************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (314 nodes) Target sequences: 1 (327 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.94 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory