Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_017598163.1 D471_RS0108160 branched-chain amino acid aminotransferase
Query= BRENDA::A0R066 (368 letters) >NCBI__GCF_000341125.1:WP_017598163.1 Length = 371 Score = 463 bits (1192), Expect = e-135 Identities = 225/362 (62%), Positives = 278/362 (76%), Gaps = 2/362 (0%) Query: 6 LEFTVSANTNPATDAVRESILANPGFGKYYTDHMVSIDYTVDEGWHNAQVIPYGPIQLDP 65 L F + + T RE +L NPGFG+ +TDHMV+I YT +GWH+A++ PYGP+ LDP Sbjct: 10 LTFDIQLSDQRKTPQEREELLENPGFGQVFTDHMVTIRYTEGKGWHDAKLEPYGPLSLDP 69 Query: 66 SAIVLHYGQEIFEGLKAYRWADGSIVSFRPEANAARLQSSARRLAIPELPEEVFIESLRQ 125 + LHY QEIFEGLKAYR DGS+ SFRPEANAAR SA R+A+P+LPE++F+ S+ Sbjct: 70 ATAALHYAQEIFEGLKAYRHPDGSLASFRPEANAARFNKSAARMAMPDLPEDLFLRSIEL 129 Query: 126 LIAVDEKWVPPAGGEESLYLRPFVIATEPGLGVR-PSNEYRYLLIASPAGAYFKGGIKPV 184 L+ D WVP + + SLYLRPF+IAT+ GLGV PS Y YLLIASP G+YF GG+KPV Sbjct: 130 LLEHDGDWVP-SKPDFSLYLRPFMIATDVGLGVNNPSRSYVYLLIASPVGSYFSGGVKPV 188 Query: 185 SVWLSHEYVRASPGGTGAAKFGGNYAASLLAQAQAAEMGCDQVVWLDAIERRYVEEMGGM 244 +VWLS +Y RA+PGGTGAAKF GNYAAS LAQAQA E GCDQVVWLDA E R+VEEMGGM Sbjct: 189 TVWLSKDYTRAAPGGTGAAKFAGNYAASFLAQAQAVEKGCDQVVWLDAREHRWVEEMGGM 248 Query: 245 NLFFVFGSGGSARLVTPELSGSLLPGITRDSLLQLATDAGFAVEERKIDVDEWQKKAGAG 304 NL+FVFG+G +ARL TP L+G+LLPGITR+SLL++A D G+ EE+ + ++EW++ A +G Sbjct: 249 NLWFVFGTGENARLRTPPLTGTLLPGITRESLLRMAPDLGYEAEEKALSIEEWREAAESG 308 Query: 305 EITEVFACGTAAVITPVSHVKHHDGEFTIADGQPGEITMALRDTLTGIQRGTFADTHGWM 364 EI+EVFACGTAAVITPV VK DGEF I DG PG +TM LR+ L G+Q G AD +GW+ Sbjct: 309 EISEVFACGTAAVITPVGFVKSDDGEFRIGDGTPGPVTMRLREELVGLQTGQRADKYGWI 368 Query: 365 AR 366 R Sbjct: 369 TR 370 Lambda K H 0.318 0.135 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 493 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 371 Length adjustment: 30 Effective length of query: 338 Effective length of database: 341 Effective search space: 115258 Effective search space used: 115258 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_017598163.1 D471_RS0108160 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01123.hmm # target sequence database: /tmp/gapView.3425.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-127 410.4 0.0 2.4e-127 410.2 0.0 1.0 1 lcl|NCBI__GCF_000341125.1:WP_017598163.1 D471_RS0108160 branched-chain am Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000341125.1:WP_017598163.1 D471_RS0108160 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 410.2 0.0 2.4e-127 2.4e-127 1 312 [. 54 370 .. 54 371 .] 0.98 Alignments for each domain: == domain 1 score: 410.2 bits; conditional E-value: 2.4e-127 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeel 69 W++a+l+++++l+ld+++a+lhY+qe+feGlkayR+ dG++ +fRp+ana+R+++sa r+++P+l+e+l lcl|NCBI__GCF_000341125.1:WP_017598163.1 54 WHDAKLEPYGPLSLDPATAALHYAQEIFEGLKAYRHPDGSLASFRPEANAARFNKSAARMAMPDLPEDL 122 ********************************************************************* PP TIGR01123 70 flealkqlvkadkdwvpkakseasLYlRPfliatednlGvk.aakeylflvlasPvGaYfkgglapvsi 137 fl++++ l++ d dwvp++ + sLYlRPf+iat+ lGv+ ++++y++l++asPvG+Yf gg++pv++ lcl|NCBI__GCF_000341125.1:WP_017598163.1 123 FLRSIELLLEHDGDWVPSKP-DFSLYLRPFMIATDVGLGVNnPSRSYVYLLIASPVGSYFSGGVKPVTV 190 *****************877.******************963788************************ PP TIGR01123 138 fveteyvRaapkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdg.. 204 +++++y+Raap+GtGa+k++GnYaas+laq++a e+g+d+vv+ld+ e++ +ee+G++n+ ++ + g lcl|NCBI__GCF_000341125.1:WP_017598163.1 191 WLSKDYTRAAPGGTGAAKFAGNYAASFLAQAQAVEKGCDQVVWLDAREHRWVEEMGGMNLWFVFGTGen 259 ****************************************************************99965 PP TIGR01123 205 .elvttplsesiLegvtresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgel 270 +l t+pl++ +L+g+tresll++a dlg+e+ee+ ++i+e+++a+e+Gei vfacGtaavitPvg + lcl|NCBI__GCF_000341125.1:WP_017598163.1 260 aRLRTPPLTGTLLPGITRESLLRMAPDLGYEAEEKALSIEEWREAAESGEIseVFACGTAAVITPVGFV 328 56789*********************************************99***************** PP TIGR01123 271 kiegkevevkseevGevtkklrdeltdiqyGkledkegWive 312 k ++ e+++ ++ +G+vt++lr+el+++q+G+ +dk+gWi++ lcl|NCBI__GCF_000341125.1:WP_017598163.1 329 KSDDGEFRIGDGTPGPVTMRLREELVGLQTGQRADKYGWITR 370 ****************************************86 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (371 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 13.19 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory