Align phosphoserine phosphatase (EC 3.1.3.3) (characterized)
to candidate WP_020565838.1 A3OW_RS0123130 haloacid dehalogenase
Query= BRENDA::P78330 (225 letters) >NCBI__GCF_000372865.1:WP_020565838.1 Length = 213 Score = 137 bits (344), Expect = 2e-37 Identities = 79/201 (39%), Positives = 117/201 (58%), Gaps = 4/201 (1%) Query: 13 SADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPS 72 S D +CFD DST+ + EGIDELA G+ + +S +T AM G VP +A +RL+LI+P Sbjct: 2 SFDVICFDCDSTLSKIEGIDELAGRVGLGEEMSRLTDAAMNGLVPLEAVYEKRLSLIRPD 61 Query: 73 REQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFA 132 R + L + G E+ S L RN ++ +ISGG R + +A L +P + V A Sbjct: 62 RAGIDWLARLYISEIVEGAAEVFSSLSARNKELHIISGGIRQAILPLAGFLGLPESRVHA 121 Query: 133 NRLKFYFNGEYAGFDETQPTAESGGKGKVI-KLLKEKFHFKKIIMIGDGATDMEACPPAD 191 + F +G Y G+D++ P A +GGK ++ +L+K + ++MIGDG TDMEA Sbjct: 122 VDVYFNEDGSYRGYDQSSPLARTGGKAEICRRLVKPEV---PLLMIGDGKTDMEAKQEGV 178 Query: 192 AFIGFGGNVIRQQVKDNAKWY 212 + IGFGG V R V++ A +Y Sbjct: 179 SVIGFGGVVARPIVRELADFY 199 Lambda K H 0.320 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 225 Length of database: 213 Length adjustment: 22 Effective length of query: 203 Effective length of database: 191 Effective search space: 38773 Effective search space used: 38773 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory