Align branched-chain amino acid aminotransferase 2; EC 2.6.1.42 (characterized)
to candidate WP_020563279.1 A3OW_RS0109885 aminodeoxychorismate lyase
Query= CharProtDB::CH_012531 (298 letters) >NCBI__GCF_000372865.1:WP_020563279.1 Length = 276 Score = 117 bits (292), Expect = 4e-31 Identities = 83/282 (29%), Positives = 132/282 (46%), Gaps = 8/282 (2%) Query: 6 IFLNGEFVPKDEAKVSVYDHGYLYGDGVFEGIRVYSGNVFRLREHLVRLYESAKSIMLEI 65 I +NGE+ +D ++S D G+ YGDG+FE I V++G L HL RL L+I Sbjct: 2 ILINGEY--RDHIEIS--DRGFQYGDGLFETIEVHNGRPVFLNRHLHRLQTGCAR--LQI 55 Query: 66 PYSLDEITNIVVETIRQNKLSNGYIRLVVSRGAGNLGLDPDSCTKPNVVVIAEQLSLFPQ 125 P E+ + +N + ++L+++RG+G G P T+P V+ +P Sbjct: 56 PCPDPELIRSEAAVLCKNA-PHAVLKLIITRGSGGRGYRPPEATRPTRVLSLHPCPDYPG 114 Query: 126 EYYEKGIPVVTVATRRNRPDVLSPQVKSLNYLNNILVRIEAKLAGVQEALMLNDQGYVAE 185 Y E+G+ V TR L+ +K LN L +L R E +QE LML+ G+V E Sbjct: 115 RYREQGVAVRICQTRLGLNPALAG-IKHLNRLEQVLARAEWDDPEIQEGLMLDINGHVIE 173 Query: 186 GSGDNVFIVKGNKLITPPSSAGALEGITRNAILEIGEKLGYDVREELFTRHDVYVADEVF 245 G+ N+F TP + ++GI R ++++ K VRE T ++ ADEVF Sbjct: 174 GTMTNLFYFSNRSAYTPALTQCGVDGIIRRILMDLLSKRRITVRETAPTVDELSAADEVF 233 Query: 246 LTGTAAEVIAVTTVDGRTIGLGQTGPHTNRLLEEFRKLVIED 287 + + + V + +G L EF+ + D Sbjct: 234 VCNSIIGIWPVRAIGNVRYAVGPFTRQCQFDLTEFKNEAVHD 275 Lambda K H 0.317 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 276 Length adjustment: 26 Effective length of query: 272 Effective length of database: 250 Effective search space: 68000 Effective search space used: 68000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory