Align Shikimate kinase; SK; EC 2.7.1.71 (uncharacterized)
to candidate WP_018123735.1 B149_RS0103265 shikimate kinase
Query= curated2:Q834S1 (168 letters) >NCBI__GCF_000375485.1:WP_018123735.1 Length = 178 Score = 95.5 bits (236), Expect = 4e-25 Identities = 60/163 (36%), Positives = 85/163 (52%), Gaps = 3/163 (1%) Query: 4 IVLIGFMGAGKTTIGQSLANKLKMPHLDLDTALIEKIGRSIPDYFEKYGEAAFREQETQL 63 I L+G GAGK+T+ LA L H+D D L GR + D F+ YG F E QL Sbjct: 16 ITLVGMAGAGKSTLAPMLAEALGWKHMDTDRLLEAFYGRPLQDIFDGYGLEEFLRIEEQL 75 Query: 64 LKELSKNTAVLSTGGGIVVGPENRSLLKSFQQVIYLHATPEELLKRITEDTENQRPLAIE 123 + E+ N V+STGG +V G L+ V++L E KR+ D E R LAI Sbjct: 76 VSEVFLNRTVISTGGSVVYGKRAVDRLRELGSVVFLEIDAETFEKRV-GDAEG-RGLAI- 132 Query: 124 RSSKEIITLFESRKNFYEECAKMTIDTTNRSPEEIINEILQQL 166 K + LF+ R+ Y A +T+ T +PEE ++EIL+++ Sbjct: 133 APGKTLRDLFDERQPLYRAAADVTVRTDRCTPEECVSEILEKV 175 Lambda K H 0.314 0.132 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 75 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 178 Length adjustment: 18 Effective length of query: 150 Effective length of database: 160 Effective search space: 24000 Effective search space used: 24000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory