Align Probable fructose-bisphosphate aldolase class 1; EC 4.1.2.13; Probable fructose-bisphosphate aldolase class I; FBP aldolase (uncharacterized)
to candidate WP_018124637.1 B149_RS0107855 fructose-bisphosphate aldolase
Query= curated2:Q9YG90 (272 letters) >NCBI__GCF_000375485.1:WP_018124637.1 Length = 265 Score = 171 bits (434), Expect = 1e-47 Identities = 93/266 (34%), Positives = 157/266 (59%), Gaps = 7/266 (2%) Query: 7 VGKRVRLSRILP--DGRSVIFAFDHGIEHGPGEIPEERLDPRLLIREVVEAGVDAIMTTP 64 +GK VR+ RI+ +GR+++ DHG+ GP +D R + +V E G +A++ Sbjct: 3 LGKAVRMERIMNRNNGRTIVVPIDHGVTVGP---IYGLVDLRKTVNQVAEGGANAMLMHK 59 Query: 65 GIARLTWDIWANRVAMIIKVSGKTSIRPQDDQFLQSAISSVDEVVALGGDGVAATVYWGS 124 GI R + + + +II +S TS+ P + ++ +++V++ ++LG D V+ + G Sbjct: 60 GIPRCSHRNYGPDIGLIIHLSASTSLSPYPNA--KTLVATVEDALSLGADAVSLHINLGD 117 Query: 125 QFEDKMLERWTRIRLRAEKLGLPALQLAYPRGPHIKNRYAVDIVAYGARAAMETGADLIK 184 + E +ML + A K G+P L + Y RGP + + Y +VA+ AR +E GAD++K Sbjct: 118 ETEPRMLADLGAVCSEANKWGMPVLAMMYARGPKVTDEYDPAVVAHCARVGVELGADIVK 177 Query: 185 TYYTGSTESFRRVVSAAGGVPVLMSGGARTPSPQEFLHKVYSVMEAGGGGVVVGRNIFQA 244 YTG+ +SFR VV+ A GVPV+++GG + S ++ + V+ ++AGG G+ VGRNIFQ Sbjct: 178 VNYTGAPDSFRNVVNGACGVPVVIAGGPKLESDRDIVQMVHDSIQAGGSGLSVGRNIFQH 237 Query: 245 GDIRAMVKAIRAIVHEGFDPEKASKL 270 D +VKA+ +VHE + + A +L Sbjct: 238 ADPSRIVKALHKVVHEDWSVDAAMEL 263 Lambda K H 0.320 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 265 Length adjustment: 25 Effective length of query: 247 Effective length of database: 240 Effective search space: 59280 Effective search space used: 59280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory