Align 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (characterized)
to candidate WP_019556283.1 F612_RS0103080 3-phosphoshikimate 1-carboxyvinyltransferase
Query= BRENDA::Q83E11 (438 letters) >NCBI__GCF_000381085.1:WP_019556283.1 Length = 447 Score = 436 bits (1122), Expect = e-127 Identities = 231/441 (52%), Positives = 305/441 (69%), Gaps = 11/441 (2%) Query: 3 YQTIPSQGLSGEICVPGDKSISHRAVLLAAIAEGQTQVDGFLMGADNLAMVSALQQMGAS 62 ++ P + G I VPGDKSISHR+++L AI+EG T V GFL G D+LA + A Q+MG Sbjct: 6 FKVQPGGTIKGRIRVPGDKSISHRSIMLGAISEGATTVTGFLEGDDSLATLKAFQEMGVQ 65 Query: 63 IQVIEDENILVVEGVGMTGLQAPPEALDCGNSGTAIRLLSGLLAGQPFNTVLTGDSSLQR 122 I+ N+ ++GVG+ GL+ P + LD GNSGTA+RL++G+LAGQ F+ L GD+SL + Sbjct: 66 IEGPNKGNV-TIQGVGLKGLKKPNKPLDMGNSGTAMRLMAGILAGQDFDCELIGDASLSK 124 Query: 123 RPMKRIIDPLTLMGAKIDST-GNVPPLKIYG--NPRLTGIHYQLPMASAQVKSCLLLAGL 179 RPMKR+ DPL MGA+I++ G +PPLKI G + LT I Y LPMASAQVKSC+LLAGL Sbjct: 125 RPMKRVTDPLRAMGAQIETAEGGMPPLKITGTGDGSLTAIDYVLPMASAQVKSCVLLAGL 184 Query: 180 YARGKTCITEPAPSRDHTERLLKHFHYTLQKDK-----QSICVSGGGKLKANDISIPGDI 234 YA+G+TC EPAP+RDHTER+L F Y + +K C+ GGGKL I +P DI Sbjct: 185 YAKGRTCALEPAPTRDHTERMLNGFGYEVISEKIDSQQMKACLMGGGKLTGRHIDVPSDI 244 Query: 235 SSAAFFIVAATITPGSAIRLCRVGVNPTRLGVINLLKMMGADIEVTHYTEKNEEPTADIT 294 SSAAFF+ AA ++ S + + VG+NPTR+G++N+L++MGADI + + E EP AD+ Sbjct: 245 SSAAFFMAAAAVSKDSDLVIEHVGMNPTRVGIVNILQLMGADITLENAHEVGGEPVADVH 304 Query: 295 VRHARLKGIDIPPDQVPLTIDEFPVLLIAAAVAQGKTVLRDAAELRVKETDRIAAMVDGL 354 VR+A LKGI+IP + V L IDEFPVL + AA A GKTVL A ELRVKE+DRI M D L Sbjct: 305 VRYAPLKGINIPKELVALAIDEFPVLFVVAASASGKTVLTGAEELRVKESDRIQVMADAL 364 Query: 355 QKLGIAAESLPDGVIIQGG--TLEGGEVNSYDDHRIAMAFAVAGTLAKGPVRIRNCDNVK 412 Q +G+ A DG++I GG T + + S+ DHRI+MA +AG A + I +C NV Sbjct: 365 QAVGVDALPTEDGMVINGGIQTKQSAVIQSHHDHRISMAMTIAGLNAVSEIVIDDCANVN 424 Query: 413 TSFPNFVELANEVGMNVKGVR 433 TSFP F+EL N+VGM V+ V+ Sbjct: 425 TSFPTFLELINQVGMQVEAVK 445 Lambda K H 0.318 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 614 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 438 Length of database: 447 Length adjustment: 32 Effective length of query: 406 Effective length of database: 415 Effective search space: 168490 Effective search space used: 168490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_019556283.1 F612_RS0103080 (3-phosphoshikimate 1-carboxyvinyltransferase)
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.24073.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-130 420.6 1.0 3.7e-130 420.4 1.0 1.0 1 lcl|NCBI__GCF_000381085.1:WP_019556283.1 F612_RS0103080 3-phosphoshikimat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000381085.1:WP_019556283.1 F612_RS0103080 3-phosphoshikimate 1-carboxyvinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 420.4 1.0 3.7e-130 3.7e-130 1 414 [. 16 439 .. 16 440 .. 0.95 Alignments for each domain: == domain 1 score: 420.4 bits; conditional E-value: 3.7e-130 TIGR01356 1 geikipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakve.eekeelviegvgg..l 66 g+i++pg+KSishR+++l+a++eg t+vt++L+++D latl+a++++G+++e +k++++i+gvg l lcl|NCBI__GCF_000381085.1:WP_019556283.1 16 GRIRVPGDKSISHRSIMLGAISEGATTVTGFLEGDDSLATLKAFQEMGVQIEgPNKGNVTIQGVGLkgL 84 79**************************************************7669*******99888* PP TIGR01356 67 kepeaeldlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgaeieskeeegslPla 135 k p++ ld+gnsGt++Rl+ g+la ++++++l gd sl+kRP++r++++Lr++ga+ie +e g +Pl+ lcl|NCBI__GCF_000381085.1:WP_019556283.1 85 KKPNKPLDMGNSGTAMRLMAGILAGQDFDCELIGDASLSKRPMKRVTDPLRAMGAQIETAE-GGMPPLK 152 **********************************************************988.69***** PP TIGR01356 136 isgp..lkg.givelsgsaSsQyksalllaaplalqavtleivgeklisrpyieitLkllksfgvevee 201 i+g+ ++ +i ++ ++aS+Q+ks++lla+ l a++ + e+ +r+++e++L+ ++ + ++ + lcl|NCBI__GCF_000381085.1:WP_019556283.1 153 ITGTgdGSLtAIDYVLPMASAQVKSCVLLAG---LYAKGRTCALEPAPTRDHTERMLNGFGYEVISEKI 218 ***98856679********************...667789999999*****************998777 PP TIGR01356 202 ede.rkivvkggqkykqkevevegDaSsAafflaaaaitge.evtvenlgenstqgdkaiiivLeemGa 268 + + k + gg+k + ++++v++D+SsAaff+aaaa+++ ++++e++g+n+t+ + i+++L+ mGa lcl|NCBI__GCF_000381085.1:WP_019556283.1 219 DSQqMKACLMGGGKLTGRHIDVPSDISSAAFFMAAAAVSKDsDLVIEHVGMNPTRVG--IVNILQLMGA 285 6665677788888888889*********************99***************..999******* PP TIGR01356 269 dveveeqr........dvevegasklkgvkv.didvdsliDelptlavlaafAegetriknieelRvkE 328 d+++e+ + dv v+ lkg+++ ++ v+ +iDe+p+l v+aa A+g+t+++++eelRvkE lcl|NCBI__GCF_000381085.1:WP_019556283.1 286 DITLENAHevggepvaDVHVR-YAPLKGINIpKELVALAIDEFPVLFVVAASASGKTVLTGAEELRVKE 353 *******99************.568******88************************************ PP TIGR01356 329 sdRiaaiaeeLeklGveveeledgllieGkkkelkgavvdtydDHRiamalavlglaaegeveiedaec 397 sdRi+++a++L+++Gv++ ++edg++i+G+ ++ ++av+++++DHRi ma++++gl a +e+ i+d + lcl|NCBI__GCF_000381085.1:WP_019556283.1 354 SDRIQVMADALQAVGVDALPTEDGMVINGGIQTKQSAVIQSHHDHRISMAMTIAGLNAVSEIVIDDCAN 422 ******************************877788********************************* PP TIGR01356 398 vaksfPeFfevleqlga 414 v++sfP F+e+++q+g+ lcl|NCBI__GCF_000381085.1:WP_019556283.1 423 VNTSFPTFLELINQVGM 439 *************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (447 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.45 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory