Align Sugar-phosphatase AraL; EC 3.1.3.23; Arabinose operon protein AraL; Phosphoserine phosphatase; EC 3.1.3.3 (uncharacterized)
to candidate WP_019865450.1 METMI_RS0106435 TIGR01458 family HAD-type hydrolase
Query= curated2:P94526 (272 letters) >NCBI__GCF_000384075.1:WP_019865450.1 Length = 260 Score = 127 bits (318), Expect = 3e-34 Identities = 81/254 (31%), Positives = 130/254 (51%), Gaps = 9/254 (3%) Query: 15 GILIDLDGTVFRGNELIEGAREAIKTLRRMGKKIVFLSNRGNISRAMCRKKLLGAGIETD 74 G+L DLDG ++ G ++GA EA++ + G F++N +S A ++K+L G Sbjct: 10 GMLFDLDGVLYVGPTAVDGAVEAVRRIHASGLPCRFVTNTSTLSLASLQQKMLALGFPIA 69 Query: 75 VNDIVLSSSVTAAFLKKHYRFSKVWVLGEQGLVDELRLAGVQNASEPKEADWLVIS-LHE 133 ++I+ + T +LK+ +L E D R EA+++V+ + + Sbjct: 70 RDEIISAPQATLLYLKRQQNPVCRLLLAEDVKQDFKRFR-----QSDTEANYIVVGDIGD 124 Query: 134 TLTYDDLNQAFQAAAGGARIIATNKDRSFPNEDGNAIDVAGMIGAIETSAQAKTELVVGK 193 +Y LN+ F GA++IA +K+R + E G +D+ G I +E A T +++GK Sbjct: 125 AWSYPLLNEVFNCLMQGAKLIAIHKNRFWQTEHGLQMDIGGFIAGLEY-ASGSTAMIIGK 183 Query: 194 PSWLMAEAACTAMGLSAHECMIIGDSIESDIAMGKLYGMKSALVLTGSAKQ--GEQRLYT 251 PS + A MGL AHE IIGD I+ D+ G+ G+K LV TG +Q Sbjct: 184 PSADFFQIALDDMGLQAHEAAIIGDDIDVDVGGGQRAGLKGVLVKTGKYRQAYAGSSAVR 243 Query: 252 PDYVLDSIKDVTKL 265 PD V+DSI+D+ L Sbjct: 244 PDLVIDSIRDLPGL 257 Lambda K H 0.317 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 260 Length adjustment: 25 Effective length of query: 247 Effective length of database: 235 Effective search space: 58045 Effective search space used: 58045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory