Align Cystathionine beta-lyase PatB; CBL; Beta-cystathionase PatB; Cysteine lyase PatB; Cysteine-S-conjugate beta-lyase PatB; EC 4.4.1.13 (characterized)
to candidate WP_019894020.1 A377_RS0100145 putative C-S lyase
Query= SwissProt::Q08432 (387 letters) >NCBI__GCF_000384235.1:WP_019894020.1 Length = 392 Score = 294 bits (753), Expect = 3e-84 Identities = 157/385 (40%), Positives = 222/385 (57%), Gaps = 2/385 (0%) Query: 3 FDKREERLGTQSVKWDKTGELFGVTDALPMWVADMDFRAPEAITEALKERLDHGIFGYTT 62 F R +R GT S K+D +LFG D LPMWVAD D P+ I AL +RL H + GY Sbjct: 6 FKYRIDREGTASEKYDLREKLFGRADVLPMWVADQDLPTPDFIVAALNKRLSHPLLGYVQ 65 Query: 63 PDQKTKDAVCGWMQNRHGWKVNPESITFSPGVVTALSMAVQAFTEPGDQVVVQPPVYTPF 122 AV W ++ G V PE I ++ V +AVQA ++ GD V+VQ PVY PF Sbjct: 66 TPTSAYQAVIDWQADK-GLSVEPEQILWTHNVANGFMLAVQALSQSGDAVLVQTPVYPPF 124 Query: 123 YHMVEKNGRHILHNPLLEKDGAYAIDFEDLETKLSDPSVTLFILCNPHNPSGRSWSREDL 182 N R ++ PL+ ++G Y IDFE E + + V LF+ C+P NPSGR W +++L Sbjct: 125 RQAPGLNDRQLVEAPLVLENGRYEIDFEQFERLVIEHQVALFLFCHPQNPSGRVWKQDEL 184 Query: 183 LKLGELCLEHGVTVVSDEIHSDLMLYGHKHTPFASLSDDFADISVTCAAPSKTFNIAGLQ 242 +L E+CL HGV +VSDEIHSDL+ H P ASLS + A VT ++P KTFN+ GLQ Sbjct: 185 ARLAEICLRHGVKIVSDEIHSDLVYVPDSHVPIASLSAEVAQSVVTLSSPGKTFNLGGLQ 244 Query: 243 ASAIIIPDRLKRAKFSASLQRNGLGGLNAFAVTAIEAAYSKGG-PWLDELITYIEKNMNE 301 I+ + RA + LQ++ + LN FA+ A+EAAYS+ G +L L ++ N+ Sbjct: 245 IGYAIMANPDWRAAYLRVLQQHSMTDLNLFALVALEAAYSQAGRDYLPHLQRHLLANIER 304 Query: 302 AEAFLSTELPKVKMMKPDASYLIWLDFSAYGLSDAELQQRMLKKGKVILEPGTKYGPGGE 361 EAF + P+V++M+P AS+LIWLDFS +Q+ ++ + + L G +G G Sbjct: 305 VEAFFALYWPRVRVMRPQASFLIWLDFSRVFPDHPAIQRFLVDQAGLGLNDGLSFGEAGR 364 Query: 362 GFMRLNAGCSLATLQDGLRRIKAAL 386 GF RLN TL L++++ A+ Sbjct: 365 GFARLNIAVPTQTLDLALKQLRQAI 389 Lambda K H 0.318 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 392 Length adjustment: 30 Effective length of query: 357 Effective length of database: 362 Effective search space: 129234 Effective search space used: 129234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory