Align fused D-3-phosphoglycerate dehydrogenase / phosphoserine phosphatase (EC 1.1.1.95; EC 3.1.3.3) (characterized)
to candidate WP_028485364.1 A377_RS0107605 phosphoglycerate dehydrogenase
Query= reanno::Cola:Echvi_2777 (630 letters) >NCBI__GCF_000384235.1:WP_028485364.1 Length = 409 Score = 425 bits (1092), Expect = e-123 Identities = 207/405 (51%), Positives = 285/405 (70%), Gaps = 1/405 (0%) Query: 227 SYPKSRINVLLLENVHPIGVEIMKQEGY-NVEVVSSAMSEEELCEKIKNVSIIGIRSKTQ 285 S K +I +LLLE H V+++ GY N+E ++SEE+L +KI++ IGIRS+TQ Sbjct: 5 SLAKDKIKILLLEGPHQSAVDVLNANGYHNIEYHKGSLSEEDLLDKIQDAHFIGIRSRTQ 64 Query: 286 ITKKVLENANRLMAVGAFCIGTNQIDLETCQEKGIAVFNAPFSNTRSVVELAISEIIFLM 345 +T+ V A +L+ VG FCIGTNQ+DL + +GI VFNAPFSNTRSV EL + EI+ L+ Sbjct: 65 LTEDVFAAAKKLVGVGCFCIGTNQVDLNAARRRGIPVFNAPFSNTRSVAELVLGEILLLL 124 Query: 346 RNLHDKTLKMHQGIWNKSASGSFEVRGKKLGIIGYGNIGAQLSVLAENMGMNVFYYDIVE 405 R++ K K HQGIW+KSA+G+ E RGK LGI+GYG+IG QL ++AEN+GM V YYDI Sbjct: 125 RDIPAKNTKAHQGIWDKSATGAVEARGKTLGIVGYGHIGIQLGIMAENIGMTVKYYDIET 184 Query: 406 RLALGNATKIDSLDELLETCDIISLHVDGRTENKNILNKEKIFKMKKGAILVNLSRGHVV 465 +L+L NA ++ +L+ELL+T D++SLHV +N++ E+ M+ GAI +N +RG VV Sbjct: 185 KLSLSNAEQVGTLEELLQTSDVVSLHVPETESTQNMMGAEQFQLMRPGAIFINAARGTVV 244 Query: 466 DVPALRDALESGHLAGAAVDVFPTEPKNNDEPFESELIGCPNTILTPHIGGSTLEAQENI 525 D+ AL +A+ESGHL+GAA+DVFP EPK NDE F S L G N ILTPHIGGSTLEAQ+NI Sbjct: 245 DIDALAEAIESGHLSGAAIDVFPVEPKTNDETFHSPLRGLSNVILTPHIGGSTLEAQKNI 304 Query: 526 AQFVPGKIIEYINSGNTFNSVNFPNIQLPFLKDAHRLIHIHQNAPGVLAKINQVLASYKI 585 + V K+++Y ++G T + NFP + LP RL+HIHQN PGV+ +IN A + Sbjct: 305 GEEVASKLVKYSDTGTTVMAKNFPEVSLPEQVGRSRLLHIHQNIPGVMTQINNAFAHQGV 364 Query: 586 NIVGQYLKTNEKIGYVITDIDKRYSNDVIDALKEIEGTIRFRILY 630 NI+ QYL+T + IGYV+ DID + + + LK I+ T+R R+L+ Sbjct: 365 NILAQYLQTMDDIGYVVIDIDAKDRDTALKELKAIKETLRVRVLH 409 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 637 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 630 Length of database: 409 Length adjustment: 34 Effective length of query: 596 Effective length of database: 375 Effective search space: 223500 Effective search space used: 223500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory